Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR318 IGR320 IGR319 IGR317 IGR322 IGR316 IGR321 CPn0391 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 CPn0399 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 CPn0399 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0389 CPn0389 dcd, - CPn0392 CPn0399 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0393 CPn0395 CPn0395 CPn0393 CPn0398
* Calculated from Protein Sequence

Gene ID: CPn0394

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tlyC_1  

Definition:
CBS Domain protein (Hemolysin Homolog)

Gene Start:
440736

Gene Stop:
441971

Gene Length:
1236

Molecular Weight*:
46331

pI*:
5.70

Net Charge*:
-5.82

EC:
 

Functional Class:

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0394 is orthologously related to CT256: residues 1-410 of CPn0394 are 57% similar to residues 1-412 of CT256, conserved hypothetical protein (hemolysin with CBS domains) from C. trachomatis.
CPn0394 is also similar to TP0649, TP0028, CT423 (all predicted hemolysin) and somewhat similar to CT257 and TP0027.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1253
COG name: Uncharacterized CBS domain-containing proteins
Functional Class:  R
The phylogenetic pattern of COG1253 is -----QVCEBRHuj--OLINX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0394 is paralogous to CPn0510: residues 182-406 of CPn0394 are 28% similar to residues 151-377 of CPn0510, a predicted CBS domain protein (hemolysin homolog) from C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 5 to 182 (E-value = 1.6e-41) place CPn0394 in the DUF21 family which is described as Domain of unknown function DUF21 (PF01595)
Residues 201 to 255 (E-value = 1.3e-05) place CPn0394 in the CBS family which is described as CBS domain (PF00571)
Residues 331 to 410 (E-value = 1.3e-22) place CPn0394 in the CorC_HlyC family which is described as Transporter associated domain (PF03471)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
26

PDB Hit:


Gene Protein Sequence:
MIPTMLMFFIICFTLCSGFISLSQIALFSLPTSLISHYKRSKSKKQQRVA
TLLLHPHHLLITLIFCDIGLNIAIQNCFAILFGDAASWWFTVGLPLAITL
ILGEILPKAVALPFNTQIASSVAPLILCVTKIFKPLLHWGIVGINYVVQW
ILSKQQIDIIQPQELKEVLQSCKDFGVVNQEESRLLYGYLSLSDCSVKER
MQPRQDILFYDIQTPLENLYLLFSKQHCSRVPICNDNLQNLLGICTARSL
LLHDKPLQSSDDLLPLLKKPYYMPETISAKMALCQMAAEDETLGMIIDEY
GSIEGLITQEDLFEIVAGEIVDQRDNKILYTTSGADVIIASGTLELREFS
EIFDINLPTNNNIATIGGWLIEQIGTIPTTGMKLSWNNLLFQVLDAAPNR
IRRVYIRKLYD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTCCTACCATGTTAATGTTCTTCATTATCTGTTTTACTTTATGCTC
GGGATTCATTTCGTTATCTCAAATTGCTTTGTTTTCTTTGCCTACGAGTT
TGATCTCGCACTATAAGCGCTCTAAATCTAAGAAACAGCAGCGAGTAGCT
ACCCTTCTTCTACATCCCCACCACCTGCTCATCACCTTAATTTTTTGTGA
TATCGGACTGAATATTGCTATTCAAAACTGTTTTGCCATTCTATTTGGAG
ATGCAGCTTCGTGGTGGTTTACTGTAGGTCTTCCTTTAGCAATTACTTTG
ATCTTAGGTGAGATTCTCCCTAAAGCAGTAGCTCTTCCTTTTAATACACA
GATTGCTAGTTCCGTAGCCCCTCTTATTCTTTGTGTTACTAAAATCTTCA
AACCCCTACTCCACTGGGGTATCGTAGGAATTAATTATGTGGTCCAATGG
ATTTTATCGAAGCAACAGATTGATATCATCCAACCCCAAGAGCTGAAGGA
AGTATTGCAAAGTTGTAAGGATTTCGGCGTAGTCAATCAAGAAGAAAGCC
GTTTACTCTATGGTTATCTTTCTCTTAGTGATTGTAGTGTTAAAGAGCGT
ATGCAGCCACGCCAGGATATTTTATTTTATGATATCCAAACCCCTTTAGA
GAACCTCTATCTTTTATTTTCTAAACAGCATTGCTCACGAGTTCCTATAT
GTAACGATAACCTCCAAAACCTTCTGGGCATTTGCACAGCGCGCTCTCTT
CTTTTACATGACAAGCCACTGCAATCTTCGGATGATCTCCTCCCCTTGCT
GAAAAAACCGTATTATATGCCAGAAACCATCTCTGCAAAAATGGCTTTAT
GTCAGATGGCAGCTGAAGACGAAACCCTAGGGATGATCATTGATGAATAC
GGATCTATTGAAGGATTGATCACTCAAGAAGACCTCTTTGAAATTGTTGC
TGGAGAAATTGTAGACCAGAGAGATAATAAAATACTCTATACCACCTCAG
GAGCTGATGTTATTATTGCCTCAGGAACTTTAGAACTCCGTGAGTTTAGT
GAGATCTTCGATATCAACCTACCGACGAACAATAATATTGCGACTATAGG
AGGCTGGTTAATAGAGCAAATCGGAACGATTCCGACAACAGGAATGAAAC
TCTCTTGGAATAACTTGCTTTTCCAGGTATTAGACGCTGCTCCGAATCGC
ATTCGCCGTGTGTATATAAGGAAATTGTATGACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy