Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR318 IGR320 IGR319 IGR317 IGR316 IGR321 CPn0391 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0398 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0389 CPn0389 CPn0398 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0393 CPn0395 CPn0395 CPn0393
* Calculated from Protein Sequence

Gene ID: CPn0393

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
440379

Gene Stop:
440726

Gene Length:
348

Molecular Weight*:
13362

pI*:
10.30

Net Charge*:
6.37

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0393 is orthologously related to CT038, a hypothetical protein: residues 1-112 are 48% similar to CT038.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
37  
68

PDB Hit:


Gene Protein Sequence:
VSKVSVRKKNWGFRLLEEVMIKSWWVIFSILIGGFVYDRAIQELRTEELR
LQSKVSSLCQDILSAQEKQRQLQLHLQHWQDSAAIEAALIQRLGLIPKGY
KKLCVSPKQQSENKD$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTCTAAAGTTTCAGTAAGAAAAAAAAACTGGGGTTTTAGATTACTAGA
AGAAGTGATGATCAAATCCTGGTGGGTGATCTTTAGCATCTTAATTGGAG
GCTTTGTTTATGATCGTGCTATCCAGGAGTTACGTACAGAAGAGCTACGC
TTACAAAGCAAGGTCTCTTCTTTATGCCAAGACATTCTTTCTGCTCAAGA
AAAGCAGCGTCAACTCCAATTACATCTGCAACACTGGCAAGACTCCGCTG
CTATAGAAGCTGCTTTAATCCAGCGTCTGGGTCTCATTCCTAAAGGCTAT
AAGAAACTCTGTGTCTCCCCAAAGCAACAATCAGAAAATAAGGACTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy