Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR318 IGR320 IGR319 IGR317 IGR315 IGR316 CPn0391 CPn0387 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 CPn0387 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 CPn0387 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0389 CPn0389 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0393 CPn0395 CPn0395 CPn0393
* Calculated from Protein Sequence

Gene ID: CPn0392

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dcd  

Definition:
deoxycytidine triphosphate deaminase

Gene Start:
439814

Gene Stop:
440386

Gene Length:
573

Molecular Weight*:
21459

pI*:
5.00

Net Charge*:
-4.80

EC:
3.5.4.13  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; 2'-deoxyribonucleotide metabolism  

Pathway: pathway table
Pyrimidine metabolism

Comment:
This enzyme converts dCTP to dUTP. It is thought to be a homotetramer.

Blast Summary:  PSI-Blast Search
CPn0392 is similar to CT039, a predicted dcd deoxycytidine triphosphate deaminase. Residues 1-190 are 82% similar to CT039.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0717
COG name: Deoxycytidine deaminase
Functional Class: F
The phylogenetic pattern of COG0717 is aMTk-q-ce-rhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MSIKEDKWIREMALNADMIHPFVNGQVNVNEETGEKLISYGLSSYGYDLR
LSREFKVFTNVYNSVVDPKCFTEDIFISITDDVCIVPPNSFALARSVEYF
RIPRNVLTMCIGKSTYARCGIIVNVTPFEPEWEGHVTIEISNTTPLPAKI
YANEGIAQVLFFESSTTCEVSYADRKGKYQKQQGITVPCV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCATAAAAGAAGATAAGTGGATACGAGAGATGGCCCTAAATGCCGA
TATGATCCATCCCTTTGTTAATGGCCAAGTGAACGTAAATGAGGAGACAG
GCGAAAAACTTATAAGTTACGGCCTATCGAGTTATGGTTACGACCTCCGC
CTATCTCGAGAATTCAAAGTGTTCACCAATGTCTATAACTCTGTTGTTGA
TCCAAAATGCTTTACTGAGGATATCTTCATCTCTATTACTGATGACGTCT
GTATTGTTCCTCCAAATTCTTTTGCTCTAGCTCGTAGCGTTGAGTATTTC
CGAATTCCTAGAAATGTCTTAACAATGTGTATAGGAAAGTCTACATATGC
ACGCTGTGGAATTATCGTAAATGTCACACCTTTTGAGCCTGAATGGGAAG
GGCATGTGACTATAGAAATTTCTAACACTACGCCATTGCCAGCGAAAATT
TACGCTAATGAAGGGATTGCCCAGGTCTTATTCTTTGAGTCTAGTACGAC
CTGCGAGGTTTCTTATGCAGACAGAAAAGGAAAGTATCAAAAGCAACAAG
GCATCACCGTACCTTGTGTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy