Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR318 IGR320 IGR319 IGR317 IGR315 IGR314 IGR316 CPn0391 CPn0387 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 CPn0387 CPn0397 ruvB, - CPn0390 yfhO,nifS, - CPn0396 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 CPn0387 ruvB, - CPn0390 yfhO,nifS, - CPn0396 CPn0389 CPn0389 CPn0397 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0393 CPn0395 CPn0395 CPn0393
* Calculated from Protein Sequence

Gene ID: CPn0391

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
439692

Gene Stop:
439507

Gene Length:
186

Molecular Weight*:
6991

pI*:
11.70

Net Charge*:
8.98

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LYKQEKPIPKATILSRNLEVMLDNPKGKRQTLFLGRTSGRSALYSYSRRI
LVLLNAFMRGP$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTATAAACAAGAAAAGCCTATCCCAAAGGCTACAATTTTATCACGAAA
CCTAGAGGTAATGTTAGATAATCCTAAGGGAAAAAGGCAAACCTTATTTT
TAGGGAGAACTTCAGGTAGGTCTGCTCTTTACTCTTATAGTAGAAGAATC
TTGGTTCTCTTGAATGCATTCATGCGAGGACCTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy