Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR318 IGR313 IGR317 IGR315 IGR314 IGR316 CPn0391 ssb, - CPn0386 CPn0387 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 ssb, - CPn0386 CPn0387 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 ssb, - CPn0386 CPn0387 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 CPn0389 CPn0389 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0393 CPn0395 CPn0395 CPn0393
* Calculated from Protein Sequence

Gene ID: CPn0389

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
438134

Gene Stop:
437316

Gene Length:
819

Molecular Weight*:
30875

pI*:
4.60

Net Charge*:
-13.20

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0389 is orthologously related to CT041, a hypothetical protein: residues 2-269 are 65% similar to residues 19-28 of CT041.5.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
23

PDB Hit:


Gene Protein Sequence:
VKLLKNVLLGLFFSMSISGFSEVKVSDTFVKQDTVVEPKIRVLLSNESTT
ALIEAKGPYRIYGDNVLLDTAIQGQRCVVHALYEGIRWGEFYPGLQCLKI
EPVDDTASLFFNGIQYQGSLYVHRKDNHCIMVSNEVTIEDYLKSVLSIKY
LEELDKEALSACIILERTALYEKLLARNPQNFWHVKAEEEGYAGFGVTKQ
FYGVEEAIDWTARLVVDSPQGLIIDAQGLLQSNVDRLAIEGFNARQILEK
FYKDVDFVVIESWNEELDGEIR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAACTATTGAAAAACGTACTTTTAGGTCTTTTCTTCAGTATGAGTAT
CTCAGGATTCTCAGAAGTAAAGGTATCCGATACTTTTGTGAAGCAGGATA
CTGTCGTTGAACCTAAAATTCGTGTCCTTTTATCTAATGAAAGCACCACA
GCTCTCATAGAAGCCAAAGGTCCTTATCGCATTTATGGAGATAATGTCTT
ATTAGACACAGCGATTCAAGGCCAGCGTTGCGTGGTCCACGCTCTATACG
AAGGGATCCGTTGGGGAGAATTTTATCCCGGACTCCAGTGTTTAAAGATC
GAGCCTGTAGATGACACTGCTTCTCTTTTTTTTAACGGGATTCAGTATCA
AGGTTCCCTATACGTTCATCGTAAAGACAACCATTGCATCATGGTTTCTA
ACGAAGTTACAATCGAAGATTATCTGAAATCTGTACTTTCTATAAAGTAC
CTTGAAGAGCTAGATAAAGAAGCTCTATCTGCTTGCATCATTCTAGAAAG
AACCGCTCTATACGAAAAGCTCCTTGCAAGAAATCCTCAAAACTTTTGGC
ATGTTAAAGCTGAAGAAGAAGGGTATGCAGGATTTGGTGTGACCAAGCAG
TTCTATGGTGTAGAAGAGGCTATAGACTGGACAGCTCGTTTAGTTGTGGA
TAGCCCTCAAGGATTAATTATAGATGCACAAGGGCTCTTGCAGTCCAACG
TAGATCGTCTTGCTATAGAAGGATTCAATGCACGTCAGATTCTTGAGAAG
TTCTACAAGGATGTGGATTTTGTAGTTATAGAATCCTGGAATGAAGAACT
GGACGGAGAGATCAGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy