Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR318 IGR313 IGR317 IGR315 IGR312 IGR311 IGR314 IGR316 CPn0391 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 dcd, - CPn0392 tlyC_1, - CPn0394 glgX, - CPn0388 CPn0391 ssb, - CPn0386 CPn0387 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 CPn0389 CPn0389 hctB, - CPn0384 dcd, - CPn0392 glgX, - CPn0388 CPn0393 tlyC_1, - CPn0394 CPn0393
* Calculated from Protein Sequence

Gene ID: CPn0388

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glgX  

Definition:
glycogen debranching protein

Gene Start:
435329

Gene Stop:
437323

Gene Length:
1995

Molecular Weight*:
75022

pI*:
6.40

Net Charge*:
-8.37

EC:
3.2.1.-  

Functional Class:
energy metabolism; sugars  

Pathway: pathway table
Aminosugars metabolism
Nucleotide sugars metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to glycogen operon protein sequences; e.g. residues 1-661 are 62% similar to CT042, a predicted glycogen debranching protein; residues 25-332 are 23% similar to CT866, a predicted 1,4-alpha-glucan branching enzyme; residues 10-618 are 42% similar to (AB015615) isoamylase [Oryza sativa]; and residues 11-574 are 43% similar to (D90908) glycogen operon protein GlgX [Synechocystis sp.].
No significant similarity to T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 6 clades of COG1523
COG name: Pullulanase and related glycosidases
Functional Class:  G
The phylogenetic pattern of COG1523 is ------vCebrh------in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 251-262 and 323-334 represent blocks PR00110B-C (ALPHA-AMYLASE SIGNATURE) with a combined E-value of 8.6e-06.

ProDom Summary:  Protein Domain Search
Residues 256-538 are 52% similar to a defined domain of P73608_XXXXX, defined as: ENZYME BRANCHING GLYCOGEN 4-ALPHA-GLUCAN TRANSFERASE GLYCOSYLTRANSFERASE BIOSYNTHESIS PRECURSOR HYDROLASE STARCH.
Residues 363-539 are 39% similar to a defined domain of ISOA_PSEAY, defined as: ISOAMYLASE PRECURSOR HYDROLASE GLYCOSIDASE SIGNAL 3D-STRUCTURE.
Residues 10-160 are 33% similar to a defined domain of O04196_ARATH, defined as: GLYCOGEN OPERON PROTEIN GLGX HYDROLASE GLYCOSIDASE ISOAMYLASE PRECURSOR SIGNAL BIOSYNTHESIS.

Paralogs:  Local Blast Search
CPn0475 is a possible paralog: residues 62-336 are 22% similar to CPn0475.

Pfam Summary:  Pfam Search
Residues 13 to 101 (E-value = 1.4e-24) place CPn0388 in the Isoamylase_N family which is described as Isoamylase N-terminal domain (PF02922)
Residues 148 to 555 (E-value = 2.8e-12) place CPn0388 in the Alpha-amylase family which is described as Alpha amylase, catalytic domain (PF00128)

PDB Hit:


Gene Protein Sequence:
MEKVSSYPSVPLPLGASKISPNRYRFALYASQATEVILALTDENSEVIEV
PLYPDTHRTGAIWHIEIEGISDQSSYAFRVHGPKKHGMQYSFKEYLADPY
AKNIHSPQSFGSRKKQGDYAFCYLKEEPFPWDGDQPLHLPKEEMIIYEMH
VRSFTQSSSSRVHAPGTFLGIIEKIDHLHKLGINAVELLPIFEFDETAHP
FRNSKFPYLCNYWGYAPLNFFSPCRRYAYASDPCAPSREFKTLVKTLHQE
GIEVILDVVFNHTGLQGTTCSLPWIDTPSYYILDAQGHFTNYSGCGNTLN
TNRAPTTQWILDILRYWVEEMHVDGFRFDLASVFSRGPSGSPLQFAPVLE
AISFDPLLASTKIIAEPWDAGGLYQVGYFPTLSPRWSEWNGPYRDNVKAF
LNGDQNLIGTFASRISGSQDIYPHGSPTNSINYVSCHDGFTLCDTVTYNH
KHNEANGEDNRDGTDANYSYNFGTEGKTEDPGILEVRERQLRNFFLTLMV
SQGIPMIQSGDEYAHTAEGNNNRWALDSNANYFLWDQLTAKPTLMHFLCD
LIAFRKKYKTLFNRGFLSNKEISWVDAMGNPMTWRPGNFLAFKIKSPKAH
VYVAFHVGAQDQLATLPKASSNFLPYQIVAESQQGFVPQNVATPTVSLQP
HTTLIAISHAKEVT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAAGTTTCTTCTTATCCCTCAGTTCCTTTACCTCTTGGGGCTTC
TAAAATTTCCCCAAACCGCTATCGATTTGCTTTATATGCTTCACAAGCTA
CCGAAGTCATCCTTGCTTTAACAGACGAAAATTCAGAAGTCATAGAAGTC
CCTCTTTACCCCGATACACACCGCACGGGTGCGATTTGGCATATAGAGAT
CGAGGGTATTTCTGATCAATCGTCTTATGCATTTCGTGTTCATGGGCCTA
AAAAGCATGGAATGCAATACTCTTTTAAAGAATATCTTGCAGATCCCTAT
GCGAAGAATATTCATTCCCCACAGAGTTTTGGTTCGCGAAAGAAACAGGG
GGATTATGCATTTTGTTATTTAAAGGAAGAACCATTTCCTTGGGATGGTG
ATCAGCCTCTGCATTTGCCGAAAGAAGAGATGATCATCTATGAGATGCAT
GTACGTTCCTTCACGCAATCTTCTTCATCTAGGGTTCATGCTCCGGGAAC
CTTCCTAGGAATCATTGAAAAGATCGACCATCTGCATAAGCTGGGAATCA
ACGCTGTTGAACTCTTACCTATCTTTGAGTTCGATGAGACTGCGCATCCT
TTTAGAAATTCGAAATTCCCTTATCTGTGCAATTATTGGGGTTATGCTCC
CCTAAATTTCTTTTCTCCTTGCCGACGTTATGCTTATGCCTCTGATCCTT
GCGCTCCAAGTAGAGAGTTTAAAACTTTAGTAAAGACCTTGCATCAAGAA
GGTATTGAGGTCATTCTTGATGTTGTTTTTAATCATACGGGCTTGCAAGG
GACGACCTGCTCTTTGCCTTGGATAGACACTCCGAGCTATTATATTTTAG
ATGCACAAGGTCACTTTACAAATTATTCAGGCTGTGGAAACACTCTCAAT
ACAAACCGCGCCCCCACGACCCAATGGATTCTCGACATCTTACGTTATTG
GGTAGAAGAAATGCATGTCGATGGGTTCCGATTTGATCTTGCTTCTGTCT
TTTCTCGTGGTCCTTCGGGATCTCCCCTACAATTCGCTCCTGTTTTAGAG
GCGATTTCTTTTGATCCTTTACTTGCGAGCACAAAGATTATAGCTGAGCC
TTGGGATGCTGGCGGTTTGTATCAGGTGGGCTATTTCCCCACACTGTCTC
CAAGATGGAGTGAATGGAACGGCCCGTATCGTGATAACGTGAAAGCATTT
CTTAATGGGGATCAAAATCTCATAGGAACCTTTGCTTCTAGAATTTCAGG
ATCTCAAGACATCTATCCTCACGGCTCGCCTACAAATTCGATTAACTATG
TCAGTTGCCATGATGGTTTTACGTTATGTGACACTGTGACTTATAACCAC
AAACATAATGAGGCTAACGGAGAGGATAATCGTGACGGCACAGATGCGAA
CTACAGCTACAATTTCGGAACGGAAGGGAAAACAGAAGACCCTGGCATTC
TTGAAGTTCGTGAAAGACAGTTACGAAATTTTTTCCTTACTTTGATGGTC
TCGCAAGGCATTCCGATGATTCAATCAGGAGATGAGTATGCCCATACCGC
GGAAGGCAATAACAACCGTTGGGCTTTGGATTCGAATGCGAATTACTTCC
TTTGGGATCAGCTTACCGCAAAGCCTACACTGATGCACTTTCTCTGTGAT
CTCATTGCGTTTCGAAAAAAATATAAAACACTTTTTAATCGAGGCTTTCT
TTCCAATAAGGAAATCAGTTGGGTAGATGCTATGGGAAATCCCATGACAT
GGCGCCCTGGAAATTTCTTAGCATTTAAAATAAAATCGCCAAAAGCGCAT
GTATATGTTGCTTTTCACGTGGGAGCTCAAGACCAACTTGCGACCTTACC
TAAAGCCTCCAGCAACTTTCTTCCTTATCAAATAGTTGCCGAGAGTCAGC
AAGGGTTTGTCCCTCAAAATGTAGCAACGCCGACAGTGTCGCTACAGCCC
CATACCACGCTAATTGCGATCAGCCATGCGAAAGAGGTTACCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy