Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR313 IGR317 IGR315 IGR312 IGR311 IGR314 IGR310 IGR316 CPn0391 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 dcd, - CPn0392 glgX, - CPn0388 CPn0391 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 dcd, - CPn0392 glgX, - CPn0388 CPn0391 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 yabC1, - CPn0382 CPn0389 yabC1, - CPn0382 CPn0389 dcd, - CPn0392 glgX, - CPn0388
* Calculated from Protein Sequence

Gene ID: CPn0387

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
435196

Gene Stop:
434696

Gene Length:
501

Molecular Weight*:
18322

pI*:
4.90

Net Charge*:
-5.47

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0387 is ortholgously related to CT043 and they share 95% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MSRQNAEENLKNFAKELKLPDVAFDQNNTCILFVDGEFSLHLTYEEHSDR
LYVYAPLLDGLPDNTQRKLALYEKLLEGSMLGGQMAGGGVGVATKEQLIL
MHCVLDMKYAETNLLKAFAQLFIETVVKWRTVCADICAGREPSVDTMPQM
PQGGGGMQPPPTGIRA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCAGGCAAAATGCTGAGGAAAATCTAAAAAATTTTGCTAAAGAATT
AAAACTGCCGGATGTAGCTTTTGATCAGAATAACACGTGCATTTTATTTG
TTGATGGTGAGTTCTCTCTTCACCTTACTTATGAAGAACATTCTGATCGT
CTTTATGTCTACGCTCCTCTGTTAGATGGACTCCCTGATAATACTCAGAG
GAAATTGGCCTTATATGAGAAATTATTAGAAGGATCTATGCTTGGCGGTC
AGATGGCTGGAGGTGGAGTAGGTGTTGCTACTAAGGAACAGCTCATTCTC
ATGCACTGCGTTTTGGATATGAAATATGCTGAAACGAATTTACTAAAAGC
ATTTGCTCAATTGTTTATTGAAACTGTTGTTAAGTGGCGTACCGTGTGTG
CTGATATTTGTGCTGGTAGAGAACCTTCTGTAGATACAATGCCACAAATG
CCTCAAGGCGGTGGTGGAATGCAACCTCCTCCTACAGGTATTCGTGCTTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy