Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR313 IGR315 IGR312 IGR311 IGR314 IGR310 IGR316 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 CPn0381 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 CPn0381 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 CPn0381 yabC1, - CPn0382 CPn0389 yabC1, - CPn0382 CPn0389 glgX, - CPn0388
* Calculated from Protein Sequence

Gene ID: CPn0386

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ssb  

Definition:
single strand DNA-binding protein (SSB)

Gene Start:
434525

Gene Stop:
434043

Gene Length:
483

Molecular Weight*:
17808

pI*:
5.40

Net Charge*:
-3.42

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
SSB binds tightly, as a homotetramer, to
single-stranded DNA (ss-DNA) and plays an
important role in DNA replication, recombination
and repair.

Blast Summary:  PSI-Blast Search
CPn0386 is weakly related to UU553, a predicted Ssb single-strand DNA binding prtoein in U. urealyticum. No similarities to T. pallidum or M. genitalium sesquences.

CPn0386 is orthologously related to CT044 and
they share 62% similarity.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0629
COG name: Single-stranded DNA-binding protein
Functional Class:  L
The phylogenetic pattern of COG0629 is ----yqvCeBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 100 (E-value = 1.7e-05) place CPn0386 in the SSB family which is described as Single-strand binding protein family (PF00436)

PDB Hit:


Gene Protein Sequence:
MMFGHFAGYLGADPEERMTSKGKRVITLRLGVKTRVGMKDETVWCKCNIW
HNRYDKMLPYLKKGSGVIVAGDISVESYMSKDGSPQSSLVISVDSLKFSP
FGRNEGSRSPSLEDNHQQVGYESVSVGFEGEALDAEAIKDKDMYAGYGQE
QQYVCEDVPF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGTTTGGGCATTTTGCTGGTTACCTTGGAGCAGATCCTGAAGAGCG
AATGACTTCCAAAGGAAAACGTGTGATCACTCTGAGACTGGGAGTGAAGA
CTCGAGTTGGAATGAAAGATGAAACTGTTTGGTGCAAATGCAATATTTGG
CACAATCGCTATGATAAGATGCTTCCTTACTTGAAGAAAGGCTCAGGAGT
CATTGTTGCTGGCGATATCTCTGTAGAGAGTTACATGAGCAAAGATGGTT
CACCGCAATCTTCTTTAGTGATTAGTGTAGATTCTTTGAAATTCAGTCCT
TTCGGTCGCAATGAAGGCAGCCGTTCTCCATCTTTAGAAGACAATCATCA
GCAAGTGGGATATGAATCTGTATCCGTAGGGTTTGAAGGTGAAGCACTGG
ACGCAGAAGCTATTAAAGATAAAGATATGTATGCTGGTTATGGTCAAGAA
CAGCAGTATGTCTGTGAAGATGTTCCTTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy