Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR313 IGR315 IGR312 IGR311 IGR314 IGR310 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 CPn0381 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 ruvB, - CPn0390 xerB,pepA,carP, - CPn0385 CPn0381 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 yabC1, - CPn0382 CPn0389 yabC1, - CPn0382 ruvB, - CPn0390 CPn0389 glgX, - CPn0388
* Calculated from Protein Sequence

Gene ID: CPn0385

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
xerB  pepA  carP  

Definition:
leucyl aminopeptidase, PepA

Gene Start:
434018

Gene Stop:
432519

Gene Length:
1500

Molecular Weight*:
54467

pI*:
6.20

Net Charge*:
-3.46

EC:
3.4.11.1  

Functional Class:
protein fate; degradation of proteins, peptides and glycoproteins  

Pathway: pathway table

Secondary Evidence:
"XERB, AN ESCHERICHIA-COLI GENE REQUIRED FOR PLASMID COLE1 SITE-SPECIFIC RECOMBINATION, IS IDENTICAL TO PEPA, ENCODING AMINOPEPTIDASE-A, A PROTEIN WITH SUBSTANTIAL SIMILARITY TO BOVINE LENS LEUCINE AMINOPEPTIDASE." 1989. STIRLING CJ, COLLOMS SD, COLLINS JF, SZATMARI G, SHERRATT DJ. EMBO JOURNAL 8(5): 1623-1627.

Comment:
From Prosite PDOC00548:

Cytosol aminopeptidase is a eukaryotic cytosolic zinc-dependent exopeptidase that catalyzes the removal of unsubstituted amino-acid residues from the N-terminus of proteins. This enzyme is often known as leucine aminopeptidase (EC 3.4.11.1) (LAP) but has been shown to be identical with prolyl aminopeptidase (EC 3.4.11.5). Cytosol aminopeptidase is a hexamer of identical chains, each of which binds two zinc ions.
Cytosol aminopeptidase is highly similar to Escherichia coli pepA, a manganese dependent aminopeptidase. Residues involved in zinc ion-binding in the mammalian enzyme are absolutely conserved in pepA where they presumably bind manganese. A cytosol aminopeptidase from Rickettsia prowazekii and one from Arabidopsis thaliana also belong to this family.

The activity is activated by manganese and inhibited by zinc and EDTA.
Believed to be a homohexamer.

Blast Summary:  PSI-Blast Search
CPn0385 is orthologously related to CT045: residues 1-499 of CPn0385 are 71% similar to residues 1-499 of CT045, a predicted leucyl aminopeptidase from C. trachomatis.
CPn0385 is also similar to MG391, UU507, both cytosol aminopeptidases.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0260
COG name: Leucyl aminopeptidase
Functional Class:  E
The phylogenetic pattern of COG0260 is -----q-cEbrHujgp--inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 179 to 491 (E-value = 2.6e-143) place CPn0385 in the Peptidase_M17 family which is described as Cytosol aminopeptidase family, catalytic domain (PF00883)

PDB Hit:


Gene Protein Sequence:
VVLFHAQASGRNRVKADAIVLPFWHFKDAKNAASFEAEFEPSYLPALENF
QGKTGEIELLYSSPKAKEKRIVLLGLGKNEELTSDVVFQTYATLTRVLRK
AKCSTVNIILPTISELRLSAEEFLVGLSSGILSLNYDYPRYNKVDRNLET
PLSKVTVIGIVPKMADAIFRKEAAIFEGVYLTRDLVNRNADEITPKKLAE
VALNLGKEFPSIDTKVLGKDAIAKEKMGLLLAVSKGSCVDPHFIVVRYQG
RPKSKDHTVLIGKGVTFDSGGLDLKPGKSMLTMKEDMAGGATVLGILSAL
AVLELPINVTGIIPATENAIDGASYKMGDVYVGMSGLSVEICSTDAEGRL
ILADAITYALKYCKPTRIIDFATLTGAMVVSLGEEVAGFFSNNDVLAEDL
LEASAETSEPLWRLPLVKKYDKTLHSDIADMKNLGSNRAGAITAALFLQR
FLEESSVAWAHLDIAGTAYHEKEEDRYPKYASGFGVRSILYYLENSLSK$


Gene Nucleotide Sequence:  Sequence Viewer
GTGGTTTTATTTCATGCTCAAGCCTCTGGGCGTAATCGTGTTAAGGCAGA
TGCTATAGTCCTGCCCTTTTGGCATTTTAAGGATGCAAAAAATGCAGCTT
CTTTTGAAGCCGAGTTTGAACCCTCGTATCTCCCCGCTTTAGAAAACTTT
CAAGGAAAAACCGGGGAGATTGAACTCCTTTATAGTAGTCCTAAAGCTAA
GGAAAAACGCATTGTCCTCTTAGGCTTAGGGAAAAATGAAGAGCTCACCT
CTGATGTTGTTTTCCAAACCTATGCGACACTAACTCGTGTCTTACGTAAA
GCAAAGTGTTCCACAGTCAATATCATCTTACCTACAATTTCTGAATTGCG
GCTTTCTGCCGAAGAATTCTTAGTGGGGTTGTCCTCAGGAATTTTGTCAT
TAAACTATGACTACCCACGTTATAATAAGGTAGATCGTAATCTTGAAACT
CCTCTTTCTAAAGTCACGGTTATCGGTATCGTTCCCAAAATGGCGGATGC
TATCTTTAGGAAAGAAGCAGCCATTTTCGAAGGCGTATATCTCACTCGAG
ATCTTGTGAACAGGAATGCTGATGAAATTACCCCTAAGAAATTGGCAGAG
GTTGCTCTGAATCTGGGAAAAGAGTTCCCTAGTATTGATACTAAGGTCTT
GGGAAAAGATGCCATCGCCAAAGAGAAAATGGGACTCCTATTGGCTGTTT
CCAAGGGTTCTTGTGTGGATCCACACTTTATCGTTGTCCGTTATCAAGGA
CGTCCTAAGTCTAAAGATCACACCGTCTTGATAGGGAAAGGGGTCACTTT
TGACTCTGGAGGTTTAGACCTCAAGCCTGGAAAATCCATGCTTACTATGA
AAGAAGACATGGCAGGTGGGGCTACAGTCCTCGGGATTCTCTCGGCGTTA
GCAGTTTTAGAGCTTCCTATAAATGTCACGGGGATCATTCCTGCTACAGA
GAATGCTATCGATGGCGCCTCCTATAAAATGGGAGATGTCTATGTAGGAA
TGTCGGGGCTTTCTGTTGAGATTTGTAGTACCGATGCTGAGGGACGTCTT
ATCCTCGCTGATGCGATTACATATGCTTTAAAATATTGTAAACCGACACG
TATTATAGATTTTGCAACTCTAACAGGAGCTATGGTAGTCTCTCTAGGAG
AAGAGGTTGCAGGTTTCTTTTCCAATAACGATGTTTTAGCTGAAGATCTT
TTAGAGGCGTCAGCCGAAACCTCCGAGCCGTTATGGAGACTTCCTCTAGT
TAAGAAGTATGATAAAACATTGCATTCTGATATTGCTGATATGAAAAATC
TAGGCAGTAACCGTGCAGGGGCTATTACAGCAGCATTATTCTTGCAGAGA
TTTTTGGAAGAATCTTCGGTAGCTTGGGCACATCTTGATATTGCAGGTAC
TGCATATCATGAAAAAGAAGAAGACCGTTATCCAAAATATGCTTCAGGTT
TTGGTGTTCGTTCTATTCTTTATTACTTAGAAAATAGTCTTTCTAAGTAG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy