Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR313 IGR315 IGR312 IGR309 IGR311 IGR314 IGR310 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 hemN_1, - CPn0380 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 hemN_1, - CPn0380 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 yabC1, - CPn0382 yabC1, - CPn0382 hemN_1, - CPn0380 glgX, - CPn0388
* Calculated from Protein Sequence

Gene ID: CPn0384

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hctB  

Definition:
histone-like protein 2

Gene Start:
432377

Gene Stop:
431859

Gene Length:
519

Molecular Weight*:
18714

pI*:
12.90

Net Charge*:
61.22

EC:
 

Functional Class:
cellular processes; chromosome-associated protein  

Pathway: pathway table

Primary Evidence:
Experimental evidence from primer extension
analysis of CT046 (the ortholog of CPn0384)
and its promoter sequence prediction can be
found in Journal of Bacteriology 177(15): 4252-4260.

Secondary Evidence:
This protein has been previously sequenced.
Gene 132 (1), 137-141 (1993) PubMed ID: 94010337.

Comment:
Histone H1-like protein KarP might have a
role analogous to that
of eukaryotic histone proteins; it is
expressed late in chlamydial development,


Blast Summary:  PSI-Blast Search
No similarities to M.genitalium, T. pallidum or U. urealyticum sequences.

CPn0384 is orthologously related to CT046, a predicted histone homolog 2: residues 1-172 are 45% similar to residues 3-203 of CT046.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPN0384 is weakly similar to CPn0886, a predicted histone-like developmental protein: residues 6-90 are 34% similar to residues 23-119 of CPn0886.

Pfam Summary:  Pfam Search
Residues 1 to 172 (E-value = 1.1e-109) place CPn0384 in the HC2 family which is described as Histone H1-like nucleoprotein HC2 (PF07382)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
172

PDB Hit:


Gene Protein Sequence:
MIGAQKKQSGKKTASRAVRKPAKKVAAKRTVKKATVRKTAVKKPAVRKTA
AKKTVAKKTTAKRTVRKTVAKKPAVKKVAAKRVVKKTVAKKTTAKRAVRK
TVAKKPVARKTTVAKGSPKKAAACALACHKNHKHTSSCKRVCSSTATRKH
GSKSRVRTAHGWRHQLIKMMSR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTGGAGCGCAAAAAAAGCAAAGCGGTAAAAAGACAGCTTCAAGAGC
TGTACGGAAGCCTGCTAAAAAAGTTGCGGCTAAACGTACGGTTAAAAAAG
CTACTGTTCGCAAAACCGCTGTAAAAAAACCTGCAGTTCGTAAGACGGCT
GCTAAAAAGACAGTAGCAAAGAAGACTACAGCTAAGAGAACAGTTCGTAA
GACTGTTGCTAAGAAGCCTGCAGTTAAGAAAGTTGCTGCTAAACGTGTAG
TAAAAAAGACAGTAGCAAAGAAGACTACAGCTAAGAGAGCGGTTCGCAAG
ACTGTTGCTAAGAAGCCTGTAGCTAGAAAAACTACAGTGGCTAAAGGTTC
TCCTAAGAAAGCTGCAGCCTGTGCTTTAGCATGCCACAAAAACCATAAGC
ATACATCTAGTTGTAAACGTGTCTGTTCTTCAACAGCTACGAGAAAGCAT
GGCTCTAAAAGCCGTGTTCGTACAGCTCATGGCTGGCGTCACCAACTGAT
CAAAATGATGTCTCGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy