Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR313 IGR315 IGR312 IGR308 IGR309 IGR311 IGR314 IGR310 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 hemN_1, - CPn0380 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 hemN_1, - CPn0380 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 yabC1, - CPn0382 yabC1, - CPn0382 hemN_1, - CPn0380 glgX, - CPn0388 CPn0379 CPn0379
* Calculated from Protein Sequence

Gene ID: CPn0383

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
431693

Gene Stop:
430746

Gene Length:
948

Molecular Weight*:
35634

pI*:
6.70

Net Charge*:
-1.24

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0383 is orthologously related to CT047, a hypothetical protein: residues 9-312 are 44% similar to CT047.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LTLPMQKSLTSFDDFSQAYAEKVPAIALIGSALEDDKDALIELLVSESFK
ELGGQGLMPATLMSWTETFALFQEHETLGIIHAEKFPLATKEFLSRYARN
PQPHLTILIFTTKQECFRELSKALPSALSLSLFGEWPADRQKRIIRLLLQ
RAERVGISCSQSLASLFLRALASTSLPDILSEFDKLLCSVGKKTSLDHSD
IKELVVKKEKASLWKFRDSLLKRDPVEGHQQLHFLLEDGEDPLGIITFLR
TQCLYGLRSIEEGSKENKHRMFVLYGKERLHQALNSLFYAETLIKNNVQD
PIVAVETLVIRMVNL$

Gene Nucleotide Sequence:  Sequence Viewer
TTGACTCTACCTATGCAAAAATCCTTAACGAGTTTTGATGACTTTTCCCA
GGCGTATGCAGAGAAAGTGCCCGCTATAGCTCTTATAGGGAGTGCTTTGG
AAGACGATAAAGATGCGCTGATTGAATTATTAGTCTCTGAGAGCTTCAAA
GAGCTCGGTGGTCAGGGACTCATGCCAGCAACCCTCATGTCTTGGACCGA
GACGTTTGCACTCTTTCAAGAGCATGAAACTTTGGGGATTATTCATGCAG
AGAAATTCCCTCTAGCAACTAAGGAATTTCTAAGCCGCTATGCTCGGAAT
CCTCAACCTCACCTTACGATTTTGATCTTCACCACAAAACAAGAATGCTT
TCGAGAACTGTCAAAAGCCTTGCCATCGGCTCTTTCTTTGAGTTTATTTG
GTGAGTGGCCCGCAGATCGTCAGAAAAGGATCATACGCCTCCTGTTGCAA
AGAGCTGAGCGTGTGGGGATTTCTTGCTCTCAATCATTGGCATCTTTGTT
TTTGCGTGCACTTGCTTCAACCTCTCTTCCTGATATTCTCAGTGAATTCG
ATAAGCTACTGTGCTCTGTTGGCAAGAAAACGTCCTTGGATCACTCTGAT
ATTAAAGAGCTCGTTGTCAAAAAAGAAAAGGCTTCCCTATGGAAATTTCG
AGACTCTCTATTGAAGAGGGATCCGGTAGAAGGTCACCAGCAGTTGCATT
TTCTACTCGAGGATGGTGAAGATCCCTTGGGGATTATTACTTTCCTTCGT
ACCCAATGTCTCTATGGTTTACGTAGTATTGAAGAGGGATCGAAAGAAAA
TAAACACCGAATGTTCGTCCTTTATGGAAAGGAGAGACTACACCAAGCCT
TAAATTCTTTATTTTATGCAGAAACCTTAATTAAAAATAATGTCCAAGAT
CCTATAGTAGCTGTGGAAACTTTAGTGATTAGAATGGTTAACCTGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy