Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR313 IGR315 IGR312 IGR308 IGR309 IGR311 IGR314 IGR310 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 sucA, - CPn0378 hemN_1, - CPn0380 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 sucA, - CPn0378 hemN_1, - CPn0380 glgX, - CPn0388 ssb, - CPn0386 CPn0387 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 sucA, - CPn0378 yabC1, - CPn0382 yabC1, - CPn0382 hemN_1, - CPn0380 glgX, - CPn0388 CPn0379 CPn0379
* Calculated from Protein Sequence

Gene ID: CPn0382

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yabC1  

Definition:
conserved hypothetical protein (possible methyltransferase); SAM-Dependent Methytransferase

Gene Start:
430749

Gene Stop:
430033

Gene Length:
717

Molecular Weight*:
26059

pI*:
8.50

Net Charge*:
4.01

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:
STD Pro database records CT048 as a conserved hypothetical protein (possible methyltransferase), but BLAST search in PSI-BLAST lists this sequence as a SAM-Dependent Methytransferase. Similarity to SAM-Dependent Methytransferases is poorly substantiated and may indicate a possible instance of database explosion.

YabC/YRAL family methyltransferase with a
modified SAM-binding loop.

Possible SAM-dependent methyltransferase (yraL) (yabC).

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to Chlamydia sequences defined as SAM-dependent methyltransferases. All other significant hits are to hypothetical protein sequences. E.g. residues 1-238 are 99% similar to (AE001622) SAM-Dependent Methytransferase [Chlamydia pneumoniae]; residues 1-234 are 61% similar to (AE001279) SAM-dependent methyltransferase [Chlamydia trachomatis]; residues 3-221 are 31% similar to (AJ132803) hypothetical protein [Staphylococcus aureus]; residues 3-213 are 30% similar to YRAL_HAEIN, a hypothetical protein; and residues 3-204 are 30% similar to YRAL_ECOLI, a hypothetical protein.
Search against STD Pro database reveals similarity to CT048, UU195, TP0975, and MG056, all of which are conserved hypothetical proteins.

CPn0382 is orthologously related to CT048: residues 1-234 of CPn0382 are 61% similar to residues 1-233 of CT048, a predicted conserved hypothetical protein (possible methyltransferase) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0313
COG name: Predicted methyltransferases
Functional Class:  R
The phylogenetic pattern of COG0313 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 86-99, 110-153, and 19-33 respectively represent blocks BL01296B-D (Uncharacterized protein family UPF0011 proteins.)

ProDom Summary:  Protein Domain Search
Residues 3-204 are 30% similar to a defined domain of YRAL_ECOLI, defined as: PROTEIN INTERGENIC REGION MG056 CONSERVED SLL0818 AGAI-MTR F286 HI1654 XPAC-ABRB.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
115  
132

PDB Hit:


Gene Protein Sequence:
VTLYLLPNTLGTRAVETLPSVIGELVHRLDGLIVESDRGGRAFLSLWKIP
EVHKFPLAILSKHARLPKAWDFYLEPIVKHGENWGLISDAGLPCIADPGA
SLVRRARALGIPVQAFSGPCSITLALMLSGLPSQSFTFLGYLPQSPKERV
KSIKKAATSKEVSTSVCIETSYRNVYTFESLLDTLPSYAELCVASDLSGP
SELVLTRQVQSWRTTEDLGSVKQSITKVPTIFLFHIPN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGACTTTATATCTTCTTCCCAATACTCTCGGTACCCGTGCTGTAGAGAC
TCTCCCCTCCGTTATAGGAGAATTAGTTCATAGACTAGATGGGCTGATTG
TAGAAAGTGATCGTGGGGGTAGGGCATTTCTAAGTTTATGGAAAATTCCC
GAAGTTCATAAATTTCCTCTTGCTATTCTTAGTAAACATGCGCGCCTCCC
TAAGGCTTGGGATTTTTATCTAGAGCCTATCGTAAAACACGGGGAGAATT
GGGGACTGATCTCTGATGCGGGTCTTCCCTGTATTGCAGATCCTGGAGCG
AGTTTAGTGCGTCGTGCACGTGCTTTGGGGATTCCTGTGCAGGCTTTTTC
AGGTCCCTGTTCGATAACGTTAGCGCTCATGCTTTCAGGCTTGCCTTCCC
AGAGCTTTACGTTTTTGGGATACCTCCCGCAAAGTCCTAAGGAACGTGTA
AAGTCGATAAAAAAGGCAGCGACCTCCAAAGAGGTATCTACTTCAGTATG
TATAGAAACTTCTTATCGTAACGTCTATACTTTTGAGTCTCTTCTAGATA
CTTTACCTTCCTATGCGGAGCTTTGTGTTGCCTCTGACCTTTCGGGCCCG
AGTGAACTTGTTCTCACACGCCAAGTGCAATCATGGAGAACTACTGAGGA
CTTAGGTTCTGTGAAGCAAAGTATAACCAAAGTCCCAACAATATTTCTTT
TCCACATCCCGAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy