Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR312 IGR308 IGR309 IGR311 IGR310 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 sucA, - CPn0378 hemN_1, - CPn0380 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 sucA, - CPn0378 hemN_1, - CPn0380 hctB, - CPn0384 CPn0383 xerB,pepA,carP, - CPn0385 CPn0381 sucA, - CPn0378 yabC1, - CPn0382 yabC1, - CPn0382 hemN_1, - CPn0380 CPn0379 CPn0379
* Calculated from Protein Sequence

Gene ID: CPn0381

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
429809

Gene Stop:
428034

Gene Length:
1776

Molecular Weight*:
65932

pI*:
6.00

Net Charge*:
-6.88

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0381 is similar to CT326, a predicted hypothetical protein. Residues 78-336 are 28% similar to CT326.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0381 is similar to CPn0066, CPn0069, CPn0882 and CPn0881. They are all predicted hypothetical proteins.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
97

PDB Hit:


Gene Protein Sequence:
MTAPTESRSSPPTLLEETEPLSPNPIPADIQIPRITISPPSLDVSTVASS
AEDISVFIAGGPRSSSSASVASDVYELVCLCGGDEDPEPPDSEVRTLYVN
GSWQTHQEAVQELLYISEVRGEAVRLLYNDGSGMSPWPISPCRTLPTLDH
PLCQALLTVWEQFFSAPENQNREFLVIFYGDASPYIQQALTQSRHSPRIV
VVGISPTVFIQGDFRVHNYRVSGDFFSSLDCRGTRAENTTILPYSSGLEG
VFLPSIRCPSFTWAVRFGEQCLVANRGEDVEDRGGLSQDAERSQLPHSER
DLAVVIDSTDPSSMSRLVEWLNQGSPSSDMEINPYPQRCPDVALSALYAI
SRVSGLAQEWILASVHEGLDLQICYSLILMHTTFAVRYFFLLFTNYPQSR
ERFRTARIVAQSLYLPSILVLVFDCGNVLRKLWMPQEILRAIFISASTIS
GSIVFVECTRWMGRGLRHRVQQFVQQRVIGSGLPVGTVRASYRDRAGFII
GFLQTVHGGLYLPVSIMVLNQIAIQVPRILVRPNNTAVYDLHNKSAEENW
SSGDVLAVGQTLNFILCAFVLFVNLWFFVKSVLRHSRRRRR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGCACCCACAGAATCTCGATCTTCACCACCAACACTACTCGAAGA
AACGGAACCTCTATCCCCAAATCCTATTCCCGCCGATATCCAAATCCCGA
GAATTACAATATCTCCTCCTTCTCTAGACGTATCAACAGTTGCATCTTCG
GCTGAAGATATCTCGGTCTTCATTGCAGGAGGCCCTAGAAGTTCTTCATC
TGCTTCTGTGGCTTCGGATGTGTATGAGTTGGTTTGCCTTTGTGGCGGTG
ATGAGGATCCTGAGCCCCCAGATTCTGAGGTACGTACTCTCTATGTAAAT
GGAAGTTGGCAAACGCATCAAGAAGCTGTACAGGAATTGCTGTATATTAG
TGAAGTACGGGGAGAGGCCGTTCGTCTTCTCTATAACGATGGAAGCGGCA
TGTCTCCTTGGCCCATCAGTCCTTGTCGTACTCTTCCTACTCTCGATCAT
CCTTTATGTCAGGCCCTTTTGACGGTTTGGGAACAGTTTTTCTCTGCTCC
TGAAAATCAGAATCGTGAGTTTCTAGTGATTTTCTATGGGGATGCATCGC
CTTATATACAACAGGCGTTAACGCAATCTAGGCATAGTCCACGTATTGTT
GTTGTAGGGATTTCCCCGACGGTCTTTATTCAAGGAGACTTTAGGGTCCA
TAATTACCGTGTTTCTGGAGACTTCTTTAGTTCTCTGGATTGTCGGGGAA
CTAGGGCGGAGAACACCACGATACTGCCGTATTCTTCGGGTCTTGAGGGT
GTTTTTCTGCCTTCTATCCGTTGTCCTTCTTTTACTTGGGCGGTGCGTTT
TGGAGAGCAATGCTTGGTTGCGAATAGGGGTGAGGATGTAGAAGATAGGG
GAGGTCTTTCTCAAGATGCCGAAAGATCACAGTTACCACACAGTGAAAGA
GATCTAGCTGTTGTCATTGATTCTACGGATCCTAGTTCTATGAGTAGGCT
TGTAGAATGGTTGAATCAAGGATCGCCTTCATCAGATATGGAAATCAATC
CCTATCCCCAACGGTGTCCTGATGTAGCTCTTTCTGCGCTTTATGCAATT
TCTAGAGTTTCAGGACTTGCGCAGGAATGGATCCTAGCCTCTGTTCATGA
GGGCTTAGACTTGCAGATCTGTTACTCTTTAATTTTGATGCACACGACGT
TTGCGGTCCGGTATTTTTTCTTACTCTTTACAAATTATCCTCAGTCTAGA
GAGAGATTCCGTACTGCACGAATCGTAGCACAATCTCTATATTTACCAAG
CATCCTTGTTCTTGTTTTTGATTGTGGCAACGTCCTGCGTAAACTATGGA
TGCCTCAGGAAATCTTACGAGCAATTTTTATTTCTGCGTCTACAATTTCA
GGGAGTATTGTCTTTGTAGAGTGCACTCGCTGGATGGGGCGAGGTCTTAG
ACATCGTGTACAACAATTTGTGCAGCAACGAGTTATAGGAAGTGGCCTGC
CTGTAGGAACAGTACGAGCTTCTTATCGCGATCGTGCAGGCTTTATCATA
GGCTTTTTACAAACTGTACATGGAGGACTTTATTTGCCGGTATCCATTAT
GGTGCTTAACCAGATTGCAATACAAGTTCCACGTATCTTAGTACGTCCAA
ATAACACTGCTGTTTATGATCTACATAATAAAAGTGCTGAAGAAAATTGG
AGCAGTGGTGATGTATTAGCTGTTGGCCAAACATTAAACTTCATCTTATG
TGCTTTCGTCTTGTTCGTAAATCTATGGTTCTTTGTGAAGTCCGTATTAC
GCCATTCTAGGCGTCGTCGTCGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy