Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR307 IGR306 IGR308 IGR309 IGR311 IGR310 hctB, - CPn0384 CPn0383 sucB, - CPn0377 CPn0381 sucA, - CPn0378 hemN_1, - CPn0380 hctB, - CPn0384 CPn0383 sucB, - CPn0377 CPn0381 sucA, - CPn0378 hemN_1, - CPn0380 hctB, - CPn0384 CPn0383 sucB, - CPn0377 CPn0381 sucA, - CPn0378 yabC1, - CPn0382 yabC1, - CPn0382 hemN_1, - CPn0380 CPn0379 CPn0379
* Calculated from Protein Sequence

Gene ID: CPn0380

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemN_1  

Definition:
oxygen-independent coproporphyrinogen III oxidase

Gene Start:
426758

Gene Stop:
427879

Gene Length:
1122

Molecular Weight*:
42252

pI*:
7.40

Net Charge*:
2.34

EC:
 

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; heme, porphyrin and cobalamin  

Pathway: pathway table

Comment:
Required for anaerobic conversion of coproporphyrinogen III
to protoporphyrinogen-IX as part of porphyrin biosynthesis.

Blast Summary:  PSI-Blast Search
CPn0380 is orthologous to CT052, a predicted oxygen-independent coproporphyrinogen III oxidase:
residues 1-373 are 64% similar to CT052. CPn0380 is also similar to TP0186, UU274 and CT746 (the
latter, a coproporphyrinogen III oxidase).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0635
COG name: Coproporphyrinogen III oxidase and related FeS oxidoreductases
Functional Class:  H
The phylogenetic pattern of COG0635 is -----QvCEBrhUJ--olINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0380 is paralogous to CPn0889, a predicted Coproporphyrinogen III Oxidase:
residues 6-309 are 26% similar to CPn0889.

Pfam Summary:  Pfam Search
Residues 10 to 178 (E-value = 3.7e-28) place CPn0380 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)
Residues 251 to 359 (E-value = 1e-31) place CPn0380 in the HemN_C family which is described as HemN C-terminal region (PF06969)

PDB Hit:


Gene Protein Sequence:
MNGKAPLALYIHIPFCTKKCRYCSFYTIPYKSESVSLYCNAVIQEGLRKL
APIQETHFIETVFFGGGTPSLVSPLDLKRILKELAPHAREITLEANPENL
TVSYLRQLQETPINRISVGVQTFDDSILQLLGRTHSSSAAITALQECQNH
GFSNLSIDLIYGLPTQSLEIFLSDLHQALTLPITHISLYNLTIDPHTSFY
KHRKILVPTIAQEEILAEMSLLAENLLLSQGFQRYELASYAKPDYPAKHN
LYYWTDRPFLGLGVSASQYLHGERSKNYSHISHYLRAVRKNLPTQETSEI
LPKKERIKEALALRLRLLEGADLAEFPSTLISMLTQDVKLQNLFSVHGQC
LALNRQGRLFHDTIAEEIMGYSF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATGGTAAGGCTCCCCTAGCTCTTTATATTCATATTCCCTTCTGCAC
AAAAAAATGTCGCTATTGCAGTTTTTATACAATCCCCTACAAAAGTGAAT
CTGTATCGCTCTATTGTAATGCTGTAATTCAAGAGGGGCTAAGAAAGCTA
GCCCCCATCCAAGAGACGCATTTCATAGAGACTGTGTTTTTTGGAGGGGG
AACACCTTCATTAGTTTCTCCTCTTGATCTTAAGCGCATCCTCAAAGAGC
TAGCCCCCCATGCCCGGGAAATTACTTTAGAGGCCAACCCCGAAAATCTC
ACCGTAAGCTATCTACGTCAACTACAAGAGACTCCAATAAATAGAATTAG
CGTTGGCGTACAAACCTTCGACGACTCTATCCTACAGCTCCTCGGAAGAA
CGCATTCTTCATCTGCGGCAATCACAGCACTGCAAGAATGCCAGAATCAC
GGATTCTCTAATCTTTCTATAGACCTAATCTACGGACTGCCCACACAGTC
TTTGGAGATATTCCTAAGCGACCTACATCAAGCTCTGACTCTCCCTATCA
CTCACATTTCTCTATACAACCTCACTATAGATCCCCACACCTCCTTCTAT
AAACACCGCAAAATTCTAGTCCCCACAATTGCCCAAGAAGAAATTCTAGC
TGAGATGAGCCTCCTTGCTGAAAATCTCCTACTCTCCCAAGGGTTCCAAC
GCTATGAACTTGCTTCATATGCCAAGCCAGATTACCCCGCAAAGCACAAC
CTCTATTACTGGACAGATCGCCCTTTCTTAGGCTTAGGAGTTTCAGCTTC
GCAATACCTTCACGGAGAGCGGTCAAAAAATTATAGTCATATTTCTCACT
ATCTACGTGCTGTACGTAAGAATCTCCCTACCCAAGAGACCTCAGAAATT
CTCCCAAAAAAAGAACGAATCAAAGAAGCCTTAGCCCTGCGACTCCGACT
CCTTGAAGGAGCAGACCTCGCGGAGTTCCCCTCCACACTTATCTCCATGC
TTACGCAAGATGTAAAATTACAAAACCTATTCAGTGTGCATGGACAATGT
CTTGCCCTAAATAGACAGGGCCGTCTCTTCCACGATACAATAGCGGAAGA
GATTATGGGATATTCCTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy