Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR307 IGR306 IGR308 IGR309 IGR310 IGR305 CPn0383 sucB, - CPn0377 CPn0381 sucA, - CPn0378 CPn0376 CPn0375 hemN_1, - CPn0380 CPn0383 sucB, - CPn0377 CPn0381 sucA, - CPn0378 CPn0376 CPn0375 hemN_1, - CPn0380 CPn0383 sucB, - CPn0377 CPn0381 sucA, - CPn0378 yabC1, - CPn0382 yabC1, - CPn0382 CPn0375 hemN_1, - CPn0380 CPn0379 CPn0379 CPn0376
* Calculated from Protein Sequence

Gene ID: CPn0379

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
426322

Gene Stop:
426768

Gene Length:
447

Molecular Weight*:
17405

pI*:
4.30

Net Charge*:
-20.01

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0379 is orthologously related to CT053 and they share 81% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
30  
61
non-globular  
73  
148

PDB Hit:


Gene Protein Sequence:
MKSERLKKLESELHDLTQWMQLGLVPKKEISRHQEEIRILEHKIYEEKER
LQLLKENGEIEEYVTPRRSPAKTVYPDGPSMSDIEFVEPTETEIDIDPGE
TVELELTDEGREDGAVEVDYSHEDDEDPFSDRNRWRRGGIIDPDANEW$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGCGAACGTCTTAAAAAATTAGAATCAGAACTTCATGACCTTAC
GCAATGGATGCAGTTGGGTTTAGTGCCAAAAAAAGAAATTAGCAGGCACC
AAGAAGAAATCCGAATCTTAGAACATAAAATTTACGAAGAAAAAGAACGT
CTACAACTCCTCAAAGAAAACGGAGAGATTGAAGAGTACGTCACACCACG
ACGCAGTCCCGCAAAGACTGTCTACCCTGATGGTCCTAGTATGTCTGATA
TTGAATTTGTGGAACCCACAGAAACAGAAATTGATATCGACCCAGGCGAA
ACCGTAGAACTGGAACTCACCGATGAAGGACGTGAAGATGGGGCAGTAGA
AGTCGACTATTCCCACGAAGACGATGAAGACCCTTTCAGCGATCGCAATC
GCTGGAGACGCGGTGGTATCATTGATCCCGATGCTAATGAATGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy