Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR307 IGR306 IGR308 IGR309 IGR304 IGR305 sucB, - CPn0377 CPn0381 sucA, - CPn0378 CPn0376 CPn0375 hemN_1, - CPn0380 gcpE, - CPn0373 sucB, - CPn0377 CPn0381 sucA, - CPn0378 CPn0376 CPn0375 hemN_1, - CPn0380 gcpE, - CPn0373 sucB, - CPn0377 CPn0381 sucA, - CPn0378 CPn0376 CPn0375 hemN_1, - CPn0380 gcpE, - CPn0373 CPn0379 CPn0374 CPn0379 CPn0374
* Calculated from Protein Sequence

Gene ID: CPn0378

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sucA  

Definition:
alpha-ketoglutarate dehydrogenase (oxoglutarate dehydrogenase)(pyruvate dehydrogenase component E1)

Gene Start:
426168

Gene Stop:
423442

Gene Length:
2727

Molecular Weight*:
103466

pI*:
5.20

Net Charge*:
-28.48

EC:
 

Functional Class:
amino acid biosynthesis; tryptophan, lysine energy metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)

Comment:


Blast Summary:  PSI-Blast Search
CPn0378 shows weak similarity to MG274, a
predicted pyruvate dehydrogenase alpha subunit.
No similarities to T. pallidum and U. urealyticum.

CPn0378 is orthologously related to CT054 and
they share 65% similarity.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0567
COG name: Pyruvate and 2-oxoglutarate dehydrogenases, E1 component
Functional Class:  C
The phylogenetic pattern of COG0567 is ----y---ebrh------inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 201 to 504 (E-value = 1.4e-37) place CPn0378 in the E1_dh family which is described as Dehydrogenase E1 component (PF00676)
Residues 569 to 763 (E-value = 2.7e-60) place CPn0378 in the Transket_pyr family which is described as Transketolase, pyridine binding domain (PF02779)

PDB Hit:


Gene Protein Sequence:
MDSEFVGQVYSSDMDWIESMYQRFMNHETLDPSWKYFFEGYQLGQAASPS
EASTKISGNETIAMLQEQKSQFLCTIYRYYGYLQSQISTLAPTTDSRFIQ
EKIAKIDLDEQVPSAGLLPKAQVSVRELIEALKKCYCGSLTLETLTCTPE
LQEFVWNLMEKRQVERFAEQLLRSYKDLCKATFFEEFLQIKFTGQKRFSL
EGGETLVPMLEHLVHYGSALGISNYVLGMAHRGRLNVLTNVLGKPYRYVF
MEFEDDPAARGLESVGDVKYHKGYVLKSHQKDRETTFVMLPNASHLESVD
PIVEGVVAALQHQGHAGKEQSSLAILVHGDAAFSGQGVVYETLQLSRVPG
YSTEGTLHIVVNNYIGFTAVPRESRSTPYCTDIAKMLGIPVFRVNSEDVV
ACIEAIEYALQVRERFSCDVIIDLCCYRKYGHNESDDPSVTAPLLYDQIK
RKKSIRELFRQYLLEGQFADISEETLASIEKEIQESLNREFQVLKGTDPE
PFPKKECHHCDRLNNGELILHDCDVSLDRETLFHMSSRLCGFPDNFHPHP
KIKTLLEKRMKMAEGGVGYDWAMAEELAFASLLIEGYNLRLSGQDSIRGT
FSQRHLVWSDTVTGDTYSPLYHLSAEQGSVEMYNSPLSEYAILGFEYGYA
QQALKTLVLWEAQFGDFANGAQIIFDQYISSGIQKWDLHSDIVLLLPHGY
EGQGPEHSSSRIERYLQLAANWNFQVVLPSTPVQYFRILREHAKRDLSLP
LVIFTPKLLLRYPQCVSSIEEFTEPGGFRAILEDADPNYDASILVLCSGK
IYYDYAEMLPQDRRKDFSCLRIESLYPLALEDLVSLIDKYSHLKHFVWLQ
EESKNMGAYDYMFMALQDILPEKLLYIGRPRSSSTASGSAKLSRQELVTC
METLFSLR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTCCGAGTTTGTGGGGCAAGTATATTCTTCGGATATGGATTGGAT
CGAGTCTATGTATCAGAGATTTATGAATCACGAGACTTTGGATCCTTCTT
GGAAGTATTTTTTTGAAGGGTATCAGCTCGGTCAAGCAGCATCTCCATCA
GAAGCTAGTACTAAGATTTCTGGGAATGAAACTATTGCTATGCTTCAAGA
ACAAAAATCTCAGTTTCTATGTACGATTTATCGTTATTATGGATATTTGC
AAAGTCAAATTTCAACGCTTGCCCCAACTACAGATTCTCGATTCATTCAG
GAAAAGATCGCTAAGATTGATCTGGATGAGCAGGTGCCTTCTGCGGGTCT
ACTTCCTAAAGCTCAGGTTTCGGTACGAGAGCTGATCGAAGCTTTAAAAA
AATGCTATTGCGGAAGTCTTACTTTAGAAACCCTAACATGTACTCCTGAG
TTGCAGGAGTTTGTTTGGAATCTTATGGAGAAGCGACAAGTGGAGCGCTT
TGCAGAGCAGCTCCTTCGCTCCTATAAAGACTTATGTAAAGCAACGTTTT
TTGAAGAGTTCTTACAGATAAAATTTACAGGTCAGAAACGTTTTTCTTTA
GAGGGCGGAGAGACCTTGGTCCCCATGTTGGAGCATCTTGTTCATTATGG
ATCGGCATTAGGAATTTCTAACTACGTTTTAGGAATGGCCCATCGAGGTC
GTTTGAATGTATTAACGAATGTTTTGGGAAAGCCTTACCGTTATGTCTTT
ATGGAGTTTGAAGACGATCCTGCAGCACGTGGTTTAGAGAGTGTTGGGGA
TGTAAAGTACCATAAAGGGTATGTGCTAAAGTCCCATCAGAAAGATAGGG
AAACTACCTTTGTGATGTTGCCAAACGCTAGTCATCTCGAATCTGTAGAT
CCTATTGTCGAGGGGGTCGTGGCTGCCTTGCAACACCAAGGTCACGCAGG
TAAAGAGCAAAGCAGCTTAGCAATTTTAGTTCATGGAGATGCAGCATTTT
CTGGTCAGGGAGTGGTTTATGAAACTCTCCAGCTGAGTCGTGTTCCAGGG
TATTCTACTGAGGGTACGCTTCACATTGTTGTGAATAATTACATAGGGTT
TACCGCAGTGCCACGGGAGTCAAGGTCCACCCCTTATTGTACGGATATTG
CTAAAATGCTAGGGATTCCTGTATTTCGAGTGAATAGCGAGGACGTCGTT
GCCTGTATAGAAGCTATAGAGTACGCTCTGCAAGTTCGTGAGAGATTTAG
TTGTGATGTGATCATAGATCTCTGCTGTTATCGCAAGTATGGACATAATG
AAAGTGACGATCCCTCAGTAACAGCTCCCTTACTCTATGATCAGATTAAG
AGAAAGAAGAGTATTCGCGAGCTGTTTAGGCAATATCTGTTGGAAGGGCA
GTTTGCAGATATTTCTGAAGAAACTTTGGCATCTATTGAAAAAGAGATTC
AAGAGAGTCTGAATCGTGAGTTTCAAGTATTGAAAGGGACGGATCCAGAA
CCCTTTCCTAAAAAAGAATGTCATCACTGCGATCGCTTAAATAACGGCGA
GCTTATTTTGCATGATTGTGATGTTTCTTTGGATCGCGAGACTCTTTTTC
ATATGAGCTCGCGTCTTTGTGGTTTCCCTGACAATTTTCATCCCCATCCT
AAAATTAAGACTCTTTTAGAAAAAAGAATGAAAATGGCAGAAGGTGGGGT
TGGTTATGATTGGGCGATGGCCGAAGAATTAGCCTTTGCTTCGCTATTAA
TCGAAGGGTACAACCTGAGACTCTCAGGTCAAGATTCTATTCGCGGGACA
TTCAGCCAACGACATTTGGTATGGAGTGATACTGTGACTGGAGATACCTA
CTCTCCATTGTACCATCTTTCTGCAGAGCAGGGCTCTGTAGAAATGTATA
ATTCTCCTCTTTCCGAATATGCAATTTTAGGGTTTGAGTATGGCTATGCT
CAACAGGCATTAAAGACTTTAGTGTTATGGGAAGCGCAGTTTGGGGATTT
TGCTAATGGTGCACAAATCATTTTCGATCAGTATATCTCTTCGGGAATTC
AGAAGTGGGATTTACACTCTGACATTGTTCTGCTTCTTCCCCATGGGTAT
GAGGGCCAAGGACCCGAGCATTCTTCATCTCGTATAGAACGTTATTTGCA
ATTAGCCGCGAACTGGAATTTTCAAGTGGTCTTGCCTTCCACTCCTGTGC
AATATTTTCGGATTCTCAGAGAGCATGCTAAGAGAGATCTTTCTTTGCCT
TTGGTGATCTTTACTCCTAAGTTGCTGCTGAGATATCCACAATGTGTAAG
TAGTATCGAGGAGTTCACAGAACCTGGGGGATTCCGTGCTATTCTCGAAG
ATGCCGATCCTAATTATGATGCTTCTATTTTGGTATTGTGTTCGGGAAAG
ATCTATTATGATTATGCAGAAATGCTTCCTCAAGATCGGCGTAAGGACTT
TTCTTGCTTGCGTATAGAGAGCTTGTATCCTTTAGCTCTTGAGGATTTAG
TGAGCCTTATCGATAAGTATTCTCATTTGAAACATTTTGTTTGGCTACAA
GAAGAATCCAAGAATATGGGGGCCTATGACTATATGTTTATGGCGTTGCA
AGACATTCTTCCTGAGAAACTGCTATATATAGGACGTCCTCGGAGTAGTT
CCACAGCTTCTGGATCAGCGAAGCTCAGTCGTCAAGAGCTGGTCACGTGT
ATGGAAACCCTCTTTTCTTTAAGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy