Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR307 IGR306 IGR308 IGR309 IGR304 IGR305 IGR303 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0376 CPn0375 hemN_1, - CPn0380 gcpE, - CPn0373 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0376 CPn0375 hemN_1, - CPn0380 gcpE, - CPn0373 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0376 CPn0375 hemN_1, - CPn0380 gcpE, - CPn0373 CPn0379 CPn0374 CPn0379 CPn0374
* Calculated from Protein Sequence

Gene ID: CPn0377

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sucB  

Definition:
dihydrolipoamide succinyltransferase (pyruvate dehydrogenase component E2)

Gene Start:
423438

Gene Stop:
422344

Gene Length:
1095

Molecular Weight*:
40052

pI*:
4.70

Net Charge*:
-15.85

EC:
2.3.1.61  

Functional Class:
energy metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)

Comment:
In HAEIN, the ODO2 enzyme converts 2-oxoglutarate
to succinyl-CoA + CO2.
The E2 component of this complex (also called the
pyruvate dehydrogenase complex)
is a dihydrolipoamide succinyltransferase.

Blast Summary:  PSI-Blast Search
CPn0377 is similar to MG272, a predicted
dihydrolipoamide acetyltransferase E2 component
in M. genitalium. No similarities to T. pallidum and U. urealyticum.

CPn0377 is orthologously related to CT055, a
predicted dihydrolipoamide succinyltransferase
(sucB). Residues 1-364 are 69% similar to CT055.
CPn0377 is also similar to CT400, a predicted
dihydrolipoamide 5-succinyltransferase and to
CT247, a predicted

COGS Summary:  COGS Search
BeTs to 8 clades of COG0508
COG name: Dihydrolipoamide acyltransferases
Functional Class:  C
The phylogenetic pattern of COG0508 is ----Y--cEBRH--gp--INX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0377 is paralogously related to CPn0527, also
a predicted dihydrolipoamide succinyltransferase
and to CPn0306, a predicted dihydrolipoamide
acetyltransferase. Residues 1-357 are 30% similar
to residues 1-389 of CPn0527 and residues 139-362
are 37% similar to residues 207-427 of CPn0306.

Pfam Summary:  Pfam Search
Residues 3 to 75 (E-value = 1.3e-13) place CPn0377 in the Biotin_lipoyl family which is described as Biotin-requiring enzyme (PF00364)
Residues 133 to 363 (E-value = 7.1e-126) place CPn0377 in the 2-oxoacid_dh family which is described as 2-oxoacid dehydrogenases acyltransferase (catalytic domain) (PF00198)

PDB Hit:


Gene Protein Sequence:
MTTEVRIPNIAESISEVTVASLLVTEGALIQENQGLLEIESDKVNQLIYA
PVSGRIFWEVSEGDVVPVGGVVGKIEPAGEGEELGDSQSKETIEAEIICF
PQSGVRQSPPENKTFIPLRDQMDQGSQGLSAGDRGETRERMTSIRKTISR
RLLSALHESAMLTTFNEVYMTPLFHLRKEKQEEFLSRYGVKLGFMSFFVK
AVLEALKAYPRVNAYIDGEEIVYRHYYDISIAVGIDRGLVVPVIRDCDKL
SNGEIEQKLADLALRAREGLLAIAELEGGGFTITNGGVYGSLLSTPIINP
PQVGILGMHKIEKRPVVLDNEIVIADMMYVALSYDHRLIDGKEAVGFLVK
VKEGLENPASLLDL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTACAGAAGTACGCATTCCTAATATTGCAGAGTCGATTAGCGAGGT
GACCGTAGCTTCCTTGTTAGTTACAGAGGGTGCTCTGATTCAAGAAAACC
AGGGCTTACTAGAAATTGAAAGTGATAAGGTAAATCAGCTCATTTATGCC
CCAGTATCGGGAAGAATTTTCTGGGAGGTTTCAGAAGGCGATGTTGTTCC
TGTAGGGGGGGTAGTGGGAAAAATAGAGCCCGCAGGTGAAGGGGAAGAGC
TTGGAGATTCTCAGTCTAAAGAGACTATAGAAGCTGAGATCATTTGCTTT
CCTCAGTCTGGGGTGCGTCAGTCTCCTCCAGAGAATAAAACGTTTATTCC
TCTTCGTGATCAGATGGACCAAGGATCCCAAGGTCTTTCTGCAGGAGATC
GAGGAGAAACTCGAGAACGCATGACCTCGATTCGTAAGACAATTTCGCGG
CGTCTTTTGTCTGCTTTACATGAGTCTGCGATGCTCACGACATTCAATGA
GGTCTATATGACACCTCTTTTTCATTTGCGAAAGGAAAAACAAGAAGAGT
TTCTATCTCGATATGGGGTGAAGTTAGGATTTATGTCTTTCTTTGTGAAA
GCTGTCTTAGAGGCTTTGAAGGCATATCCACGAGTGAACGCCTATATTGA
TGGCGAGGAGATTGTTTACCGTCACTATTATGACATTTCTATTGCTGTAG
GTATCGATCGAGGACTTGTGGTTCCTGTGATACGCGATTGCGATAAACTT
TCTAACGGGGAGATTGAGCAGAAACTCGCAGATCTTGCCCTTCGGGCTCG
TGAAGGCCTACTTGCAATAGCGGAGCTTGAGGGAGGAGGTTTCACAATTA
CCAATGGAGGCGTATATGGATCGCTACTTTCGACTCCCATTATCAATCCC
CCGCAAGTGGGGATTTTGGGGATGCATAAGATAGAAAAGCGCCCCGTTGT
TCTTGATAATGAAATTGTAATTGCAGATATGATGTATGTCGCTTTAAGCT
ATGATCATCGTCTTATTGATGGGAAAGAGGCTGTTGGGTTTTTAGTCAAA
GTGAAAGAAGGCCTAGAGAATCCTGCCTCATTACTCGACTTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy