Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR307 IGR306 IGR308 IGR304 IGR302 IGR301 IGR305 IGR303 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0371 CPn0376 CPn0379 CPn0375 CPn0370 gcpE, - CPn0373 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0371 CPn0376 CPn0379 CPn0375 CPn0370 gcpE, - CPn0373 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0376 CPn0379 CPn0375 CPn0370 gcpE, - CPn0373 CPn0374 CPn0374 CPn0371
* Calculated from Protein Sequence

Gene ID: CPn0375

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
421121

Gene Stop:
421618

Gene Length:
498

Molecular Weight*:
17909

pI*:
10.50

Net Charge*:
6.71

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
48  
72
transmembrane  
77  
98
non-globular  
99  
165

PDB Hit:


Gene Protein Sequence:
MKLGASTNHKVHEPVKPKKAQLAEIEANKTQATEGTLRSKSLALQIARAV
LYILFAALMLAAGITFVTFLALGFPLIQAYSIAGIITLVGLAIGLVLLIL
SLLPKEDEEADALSRNALLPLTIIVIEQQPITPKPEIPYSYLTKLALLTS
LFLTLRRSSSQRKTH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTAGGCGCATCAACTAATCATAAAGTTCACGAACCAGTGAAGCC
AAAAAAAGCGCAACTCGCTGAGATTGAAGCTAACAAAACCCAAGCTACAG
AAGGCACACTCAGAAGTAAAAGTCTTGCTCTTCAAATTGCGCGTGCTGTT
CTTTACATACTTTTCGCTGCACTAATGTTAGCAGCTGGAATCACGTTCGT
TACCTTCTTAGCTTTAGGCTTCCCTCTAATACAGGCGTATAGCATTGCTG
GTATTATCACACTCGTGGGATTAGCCATCGGGCTCGTGCTTCTCATCTTG
AGCTTGTTGCCTAAAGAAGACGAGGAAGCAGATGCACTTTCTAGAAACGC
TCTTCTTCCATTAACCATCATTGTAATCGAGCAACAACCCATCACTCCTA
AACCTGAGATCCCCTATTCTTATTTAACTAAACTAGCCCTATTAACATCA
TTGTTCCTTACCTTACGACGCTCTTCCTCCCAAAGAAAAACTCACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy