Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR307 IGR306 IGR304 IGR302 IGR301 IGR300 IGR305 IGR303 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0371 CPn0376 CPn0375 CPn0370 gcpE, - CPn0373 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0371 CPn0376 CPn0375 CPn0370 gcpE, - CPn0373 sucB, - CPn0377 sucA, - CPn0378 CPn0371 CPn0376 CPn0375 CPn0370 gcpE, - CPn0373 CPn0374 CPn0374 CPn0372
* Calculated from Protein Sequence

Gene ID: CPn0374

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
420218

Gene Stop:
420964

Gene Length:
747

Molecular Weight*:
27987

pI*:
8.40

Net Charge*:
6.60

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0374 is orthologously related to CT056, a conserved hypothetical protein: residues 3-247 are 55% similar to CT056.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1496
COG name: Uncharacterized ACR, YfiH family
Functional Class:  S
The phylogenetic pattern of COG1496 is -----q-cebrh----o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 21 to 245 (E-value = 6.4e-123) place CPn0374 in the DUF152 family which is described as Uncharacterised ACR, YfiH family COG1496 (PF02578)

PDB Hit:


Gene Protein Sequence:
MTLSFHTHPLNYWTFEEFDGLPIRHGVFSKQKDAEGTVFAAKNPEIASAL
QSPKYCDLHQRHGTSVRCVTPTSPTYQPADGLCTQSPLLSLHIRHSDCQA
AIFYDREHHAIANVHSGWRGLLGNIYAVTVGTMKKLFHTKPQDLFVAIGP
SIGPDYAIYPDYATLFPRSFLPFMNPKNHFDLRAIARKQLTNLGISKDRI
FISDLCTYTEHDAFFSSRYLAHHPDPNLTGQHSKNRNNVTAVLLLPRD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCTATCCTTCCACACTCACCCTCTGAACTATTGGACTTTCGAAGA
ATTCGATGGTTTGCCTATACGCCACGGAGTCTTTTCAAAACAAAAGGATG
CCGAGGGCACGGTCTTCGCAGCCAAGAATCCTGAGATTGCTTCAGCTCTC
CAATCTCCGAAGTATTGCGACCTTCATCAACGCCACGGCACTTCCGTACG
TTGTGTTACACCTACATCCCCCACCTACCAACCTGCAGACGGACTGTGCA
CGCAGTCTCCGCTCCTCTCTCTCCATATCCGCCATTCCGATTGCCAAGCA
GCTATCTTTTATGATCGAGAACACCACGCAATCGCAAATGTACACAGCGG
ATGGCGAGGATTGCTTGGCAATATCTATGCTGTCACCGTAGGTACTATGA
AAAAATTATTTCATACAAAACCACAAGATCTCTTCGTAGCTATCGGCCCT
TCCATCGGTCCAGATTATGCTATCTATCCCGATTACGCTACGTTATTTCC
TCGTAGCTTTCTTCCCTTTATGAATCCCAAAAACCATTTTGACCTGCGTG
CGATTGCTCGCAAGCAACTTACGAATTTAGGAATCTCTAAAGACCGCATT
TTTATCTCAGACCTCTGTACCTACACGGAACACGACGCTTTCTTTTCTTC
AAGGTACCTTGCTCACCATCCCGATCCCAATCTCACAGGCCAACATTCAA
AAAATAGAAATAATGTAACCGCCGTCCTTCTCCTACCCAGAGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy