Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR307 IGR306 IGR304 IGR302 IGR301 IGR300 IGR305 IGR299 IGR303 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0371 CPn0376 CPn0375 CPn0370 CPn0369 gcpE, - CPn0373 sucB, - CPn0377 sucA, - CPn0378 CPn0372 CPn0371 CPn0376 CPn0375 CPn0370 CPn0369 gcpE, - CPn0373 sucB, - CPn0377 sucA, - CPn0378 CPn0371 CPn0376 CPn0375 CPn0370 CPn0369 gcpE, - CPn0373 CPn0374 CPn0374 CPn0372
* Calculated from Protein Sequence

Gene ID: CPn0373

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcpE  

Definition:
conserved hypothetical protein (GcpE family protein)

Gene Start:
418380

Gene Stop:
420221

Gene Length:
1842

Molecular Weight*:
68300

pI*:
6.50

Net Charge*:
-7.49

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
In E.coli, the GCPE gene (gcpE) is said to be essential.

Blast Summary:  PSI-Blast Search
Cpn0373 is orthologously related to CT057: residues 3-609 of CPn0373 are 60% similar to residues 1-604 of CT057, a predicted conserved hypothetical protein (GcpE family protein) from C. trachomatis.
CPn0373 is also similar to TP0446, a predicted GcpE-related protein (protein E) from T. pallidum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0821
COG name: Essential bacterial protein GcpE, involved in density-dependent regulation of peptidoglycan biosynthesis
Functional Class:  M
The phylogenetic pattern of COG0821 is -----qvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 12 to 363 (E-value = 3.8e-67) place CPn0373 in the GcpE family which is described as GcpE protein (PF04551)

PDB Hit:


Gene Protein Sequence:
MTLITPAINSSRRKTHTVRIGNLYIGSDHSIKTQSMTTTLTTDIDSTVEQ
IYALAEHNCDIVRVTVQGIKEAQACEKIKERLIALGLNIPLVADIHFFPQ
AAMLVADFADKVRINPGNYIDKRNMFKGTKIYTEASYAQSLLRLEEKFAP
LVEKCKRLGKAMRIGVNHGSLSERIMQKYGDTIEGMVASAIEYIAVCEKL
NYRDVVFSMKSSNPKIMVTAYRQLAKDLDARGWLYPLHLGVTEAGMGVDG
IIKSAVGIGTLLAEGLGDTIRCSLTGCPTTEIPVCDSLLRHTKIYLDLPE
KKNPFSLQHSENFVSAAEKPAKTTLWGDVYGVFLKLYPHHLTDFTPEELL
EHLGVNPVTKEKAFTTPEGVVVPPELKDAPITDVLREHFLVFHHHQVPCL
YEHNEEIWDSPAVHQAPFVHFHASDPFIHTSRDFFEKQGHQGKPTKLVFS
RDFDNKEEAAISIATEFGALLLDGLGEAVVLDLPNLPLQDVLKIAFGTLQ
NAGVRLVKTEYISCPMCGRTLFDLEEVTTRIRKRTQHLPGLKIAIMGCIV
NGPGEMADADFGFVGSKTGMIDLYVKHTCVKAHIPMEDAEEELIRLLQEH
GVWKDPEETKLTV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACACTCATTACCCCTGCCATCAATTCCTCGCGACGCAAAACCCATAC
AGTAAGAATAGGCAACTTATACATAGGCAGTGACCACTCAATAAAAACCC
AATCAATGACAACGACATTAACCACAGACATTGACAGTACAGTAGAGCAA
ATCTACGCTCTAGCGGAACATAATTGTGATATTGTCAGAGTGACTGTACA
GGGAATCAAGGAAGCACAAGCCTGTGAAAAAATTAAAGAACGTCTGATTG
CTCTAGGGTTAAATATCCCTTTGGTTGCAGATATCCACTTCTTCCCTCAA
GCAGCTATGTTAGTTGCTGATTTTGCTGACAAGGTTCGCATCAATCCAGG
CAACTACATAGATAAGAGGAACATGTTCAAGGGGACGAAGATCTATACAG
AGGCAAGCTATGCCCAAAGTCTCCTGCGTCTTGAAGAAAAGTTTGCTCCT
TTAGTAGAGAAATGTAAGCGACTAGGCAAGGCTATGCGCATTGGAGTGAA
CCACGGGTCACTTTCCGAAAGAATCATGCAAAAATATGGCGACACTATCG
AAGGAATGGTAGCCTCAGCAATTGAATATATCGCTGTATGTGAAAAGCTG
AATTATAGAGATGTTGTCTTCTCAATGAAATCTAGCAATCCGAAGATCAT
GGTAACTGCATACCGCCAACTTGCTAAAGACTTAGATGCTAGAGGCTGGC
TCTATCCCCTTCACCTTGGAGTTACTGAAGCTGGAATGGGCGTGGACGGG
ATCATAAAATCCGCAGTAGGAATCGGAACTCTTCTTGCCGAAGGACTCGG
GGATACCATACGCTGCTCTCTCACAGGGTGTCCCACTACAGAAATTCCTG
TCTGTGATAGCTTGCTACGCCATACGAAAATCTACTTAGACCTTCCAGAA
AAGAAAAATCCCTTTTCCCTACAACACTCCGAAAACTTTGTTTCTGCTGC
AGAGAAGCCTGCGAAAACAACACTTTGGGGAGACGTCTACGGAGTCTTTT
TAAAACTCTATCCTCACCATCTTACCGACTTTACTCCTGAAGAACTCTTA
GAACACTTGGGGGTAAATCCCGTAACAAAAGAAAAAGCATTCACAACTCC
TGAAGGGGTCGTCGTTCCCCCTGAGTTAAAAGATGCTCCTATTACAGATG
TACTTCGAGAACACTTTTTAGTTTTCCACCACCATCAAGTGCCTTGCCTA
TATGAACACAATGAGGAGATTTGGGATAGCCCTGCTGTTCATCAAGCTCC
ATTTGTGCATTTTCATGCTTCAGACCCCTTCATTCATACCTCCCGAGATT
TCTTTGAAAAACAAGGACACCAAGGAAAACCGACCAAGCTAGTATTTTCA
AGGGACTTTGACAATAAAGAAGAAGCTGCTATTTCCATAGCAACAGAGTT
TGGAGCTCTGCTTCTTGATGGCCTTGGAGAAGCTGTGGTTCTTGACTTAC
CGAACCTTCCCCTACAGGACGTGCTAAAAATTGCCTTTGGCACTCTACAA
AATGCAGGGGTGCGCCTTGTAAAAACAGAGTACATCTCCTGTCCTATGTG
TGGTCGGACCCTCTTTGATCTTGAAGAAGTCACCACACGTATCCGCAAGA
GAACGCAGCACCTACCAGGACTTAAGATCGCTATCATGGGTTGTATTGTG
AATGGCCCTGGAGAAATGGCAGATGCAGATTTTGGATTTGTAGGTTCCAA
AACAGGGATGATCGATCTTTATGTAAAACATACTTGTGTAAAAGCTCACA
TACCCATGGAAGATGCTGAAGAAGAATTAATTCGACTTTTACAAGAACAT
GGGGTATGGAAAGACCCTGAAGAAACTAAGTTGACAGTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy