Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR306 IGR304 IGR302 IGR301 IGR300 IGR305 IGR299 IGR303 IGR298 CPn0372 CPn0371 CPn0376 CPn0366 CPn0375 CPn0367 CPn0370 CPn0369 gcpE, - CPn0373 CPn0372 CPn0371 CPn0376 CPn0366 CPn0375 CPn0367 CPn0370 CPn0369 gcpE, - CPn0373 CPn0371 CPn0366 CPn0375 CPn0370 CPn0369 gcpE, - CPn0373 CPn0368 CPn0374 CPn0374 CPn0367 CPn0372 CPn0376 CPn0368
* Calculated from Protein Sequence

Gene ID: CPn0371

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
417147

Gene Stop:
417506

Gene Length:
360

Molecular Weight*:
12614

pI*:
10.80

Net Charge*:
9.36

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
37  
119

PDB Hit:


Gene Protein Sequence:
MPVSSAPLPTSHRPSSGNLGLMEPNSKALKAKHQDKTTKTIKLLVKILVA
ILVIEVLGIIAAFFIPGTPPICLIILGGLILTTVLCVLLLVIKLALVNKT
EGTTAEQQIKRKLSSKSIS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCGTGTCCTCAGCCCCCCTACCCACAAGCCACCGCCCTTCCTCTGG
AAATCTAGGCCTCATGGAACCAAATTCCAAAGCTCTAAAAGCAAAGCATC
AAGATAAAACGACGAAGACGATTAAACTTTTAGTTAAAATCCTTGTTGCC
ATTCTAGTAATAGAAGTTTTAGGAATAATTGCAGCTTTCTTTATTCCTGG
GACTCCTCCCATCTGCTTGATTATCCTAGGAGGCCTTATTCTTACAACAG
TACTCTGTGTGCTTCTTCTTGTTATAAAGCTTGCCCTTGTAAACAAAACC
GAAGGAACAACTGCTGAACAGCAGATAAAACGTAAACTCTCTTCTAAAAG
TATTTCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy