Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR304 IGR302 IGR301 IGR300 IGR299 IGR303 IGR297 IGR298 CPn0372 CPn0371 CPn0366 CPn0375 CPn0367 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 CPn0372 CPn0371 CPn0366 CPn0375 CPn0367 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 CPn0371 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 CPn0368 CPn0374 CPn0375 CPn0367 CPn0372 CPn0366 CPn0368 CPn0374
* Calculated from Protein Sequence

Gene ID: CPn0370

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
415800

Gene Stop:
416915

Gene Length:
1116

Molecular Weight*:
40558

pI*:
8.20

Net Charge*:
3.26

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0370 is similar to CT058, a Chlamydia-specific hypothetical protein: residues 38-363 are 25% similar to CT058.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0370 is similar to CPn0369, CPn0107 and CPn0367, all hypothetical proteins: residues 6-371 are 35% similar to CPn0369; residues 133-370 are 39% similar toCPn0107; residues 7-252 are 33% similar to CPn0367.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
134

PDB Hit:


Gene Protein Sequence:
MSTTEPNLTNVNLTMLISSESMPTQLASHKLKGLDLVAFILIIGIAVSSG
TAAIILGIPLLFILTALAVLAFSILLYFLLREPKSPISVTHQPTPIIKDT
DLPPVPPLALTPVPTEAVLEEPPLPSPRTHQTLLQENWDRIPDLQANTDM
PFIAADNQTGYAWHLKNSNLTLISTLGPIEKPRYKTQGIVMIVNAATPNM
ANNVKGTSLALAKATSVRCWENSKKSPDPLRSKQPLQLGECRSAKWENLN
GTTNAGKAGLPQFLGQLLGPKASDYNYNPNDAFTFCRQAYLNCLNEAKRR
KTTVVQLPLLSSHFPGSPKDEETTSLRLQWIDGVKLALIDALQTFGSEAE
NQNQPWVIILTTLARHPLITP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCACCACAGAACCCAATTTGACTAACGTAAATCTAACCATGCTGAT
CAGCAGCGAAAGCATGCCCACGCAACTCGCATCTCATAAGCTCAAAGGTC
TGGACCTTGTCGCTTTTATTCTAATTATAGGAATTGCTGTAAGTTCTGGA
ACCGCTGCTATAATTTTAGGCATTCCTCTATTATTTATTCTTACCGCTCT
AGCAGTCTTGGCTTTTAGTATTCTTCTCTATTTTCTCTTAAGAGAACCTA
AAAGTCCTATAAGCGTAACGCATCAGCCGACGCCCATCATAAAAGATACA
GACCTTCCTCCTGTCCCGCCCCTAGCACTCACCCCAGTGCCTACGGAAGC
TGTCCTAGAAGAGCCCCCGCTTCCTTCCCCTAGAACCCATCAAACACTGT
TACAAGAAAATTGGGACCGTATACCTGATCTACAGGCTAACACAGATATG
CCTTTCATCGCTGCTGACAATCAAACCGGTTATGCTTGGCATTTGAAAAA
CTCAAACCTGACTTTGATCTCTACGTTAGGGCCCATTGAAAAGCCTCGCT
ATAAAACTCAAGGCATCGTCATGATTGTGAATGCAGCCACCCCAAACATG
GCAAACAACGTAAAAGGAACAAGTCTCGCACTTGCGAAAGCAACTAGTGT
ACGCTGTTGGGAAAATTCGAAAAAATCTCCGGATCCTCTCCGTTCAAAAC
AGCCCCTACAATTAGGAGAATGCCGCTCAGCAAAATGGGAAAATCTAAAC
GGAACCACGAATGCAGGTAAAGCAGGACTACCGCAATTCTTAGGACAACT
TCTAGGGCCGAAAGCTTCTGACTATAACTACAATCCTAATGATGCGTTTA
CCTTTTGTAGGCAAGCCTACCTTAACTGTTTGAATGAGGCCAAGCGCCGT
AAAACAACCGTAGTTCAGCTCCCCTTGCTTTCCTCCCATTTCCCTGGCTC
TCCAAAAGACGAAGAGACTACTAGTCTACGTCTGCAATGGATTGATGGTG
TGAAGTTAGCCTTGATAGATGCTCTGCAGACATTTGGATCAGAAGCAGAA
AATCAAAATCAACCGTGGGTTATCATTTTGACAACTCTTGCTAGACATCC
CCTCATCACACCCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy