Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR302 IGR301 IGR300 IGR299 IGR295 IGR296 IGR303 IGR297 IGR298 fer, - CPn0364 CPn0372 CPn0371 CPn0366 CPn0367 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 fer, - CPn0364 CPn0372 CPn0371 CPn0366 CPn0367 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 fer, - CPn0364 CPn0371 CPn0366 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 CPn0368 CPn0367 CPn0372 CPn0368
* Calculated from Protein Sequence

Gene ID: CPn0369

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
414351

Gene Stop:
415565

Gene Length:
1215

Molecular Weight*:
44327

pI*:
5.00

Net Charge*:
-9.81

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0369 is similar to CT058, a chlamydia-specific hypothetical protein: residues 40-392 are 25% similar to CT058.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0369 is similar to CPn0370, CPn0107 and CPn0367, all Chlamydia-specific hypothetical proteins. Residues 8-397 are 35% similar to CPn0370; residues 156-398 are 39% similar to CPn0107; residues 30-279 are 35% similar to CPn0367.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
45  
69
transmembrane  
74  
91
non-globular  
93  
185
transmembrane  
325  
342

PDB Hit:


Gene Protein Sequence:
MTDSNPLPSYTDASLYRTPAKHSYPIRLPLNRTDRIEKILKIVTLTLALA
CALGFSIAAGILAMPIFSAVVVITLAIAAVSLYSLLKKPKLYEILPQIEP
ESEQSSLSPSPQPPEQQDLPLQIDPLPDPESLPEVSLADLTTPPEELTAI
TVTPGYEALLEQNWDLLPSLAAVDPSFTTETPQQPCFIWKLKDSKLIFIS
TSGDIAVPRIKTQGRVMIVNAANENISREGGGTNKALSLATSLQCWNASR
LPRAHSRSGSQLQPGECRSAKWENSDHTSNDHVPGKAHFLAQLLGPEAAK
CNNDPKQAFEVSKKAFHNLFQEAEIIGVDVIQLPLIGCNLFAPSRLLNLG
KTRAEWIEAIKLALITSLQDFGWEQDNQEEQKIIILTDKDQPPIIPPRFD
LTTP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAGATTCTAATCCCCTACCCTCTTATACAGACGCCAGTCTCTACAG
AACTCCTGCGAAACATTCCTATCCGATTAGACTCCCTCTCAACCGTACAG
ATAGAATCGAGAAAATACTGAAAATTGTCACCCTCACACTAGCCCTAGCG
TGCGCTTTGGGCTTTAGCATTGCTGCTGGCATTTTGGCTATGCCTATTTT
TTCTGCCGTAGTTGTCATAACATTAGCAATTGCTGCGGTCTCACTTTACT
CCCTTTTAAAGAAACCTAAATTATACGAGATTCTTCCTCAAATCGAACCC
GAATCTGAGCAAAGTTCTCTGTCTCCCTCTCCCCAGCCTCCTGAGCAACA
GGACCTCCCTTTGCAGATCGATCCACTTCCCGATCCCGAATCACTCCCCG
AAGTCTCTCTTGCTGATCTAACCACACCCCCAGAAGAACTTACCGCTATC
ACGGTCACTCCTGGCTATGAGGCTCTTCTTGAACAAAACTGGGATCTTCT
TCCGAGCTTAGCCGCTGTAGACCCATCGTTTACTACAGAAACACCTCAGC
AGCCCTGTTTTATTTGGAAGCTTAAAGACTCGAAGCTTATCTTTATATCT
ACCTCAGGAGATATTGCAGTTCCAAGAATCAAAACTCAAGGCAGGGTGAT
GATTGTTAACGCAGCAAACGAGAACATCTCCCGAGAAGGAGGGGGAACGA
ATAAAGCTCTATCCCTGGCTACAAGTCTACAGTGTTGGAACGCATCTAGG
CTCCCTAGAGCGCACTCTCGTTCTGGATCCCAACTACAGCCAGGAGAATG
CCGCTCAGCAAAATGGGAAAATAGTGATCACACCTCAAACGACCATGTCC
CAGGCAAAGCACACTTCTTAGCACAACTGCTTGGTCCCGAAGCTGCTAAG
TGTAACAACGATCCTAAGCAAGCATTTGAAGTAAGCAAGAAAGCGTTTCA
TAACCTGTTCCAAGAAGCTGAAATCATAGGCGTTGATGTGATTCAACTCC
CCCTCATTGGATGTAATCTATTTGCTCCATCAAGACTTCTAAACCTCGGG
AAAACAAGAGCAGAATGGATCGAGGCTATAAAATTGGCACTCATCACATC
TCTTCAAGATTTTGGATGGGAACAAGACAACCAGGAAGAGCAAAAAATTA
TCATCCTTACAGACAAGGACCAGCCTCCCATCATTCCACCCCGTTTCGAT
CTAACGACTCCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy