Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_1 IGR302 IGR301 IGR300 IGR299 IGR295 IGR296 IGR303 IGR297 IGR298 flhA, - CPn0363 fer, - CPn0364 CPn0372 CPn0371 CPn0366 CPn0367 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 flhA, - CPn0363 fer, - CPn0364 CPn0372 CPn0371 CPn0366 CPn0367 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 flhA, - CPn0363 fer, - CPn0364 CPn0371 CPn0366 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 CPn0368 CPn0367 CPn0372 CPn0368
* Calculated from Protein Sequence

Gene ID: CPn0368

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
413790

Gene Stop:
414110

Gene Length:
321

Molecular Weight*:
11568

pI*:
7.60

Net Charge*:
0.90

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
There is weak similarity to CT058, and all of the paralogs are described as having similarity to CT058.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of hits to sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical proteins in C.pneumoniae:

Residues 8-101 are 41% similar to residues 126-206 of CPn0107.
Residues 16-86 are 43% similar to residues 280-349 of CPn0369.
Residues 18-87 are 42% similar to residues 253-322 of CPn0370.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
VNAAQHPGSIETGRINDTNPGEAHFLAQLLGPKYEGELKAHPEKLSNVIK
KAYLNCFDEALNNQATVVQVPLISSSIYSPGGKLELEPVNQTKPNSSAYK
LYHIRT$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATGCCGCTCAGCACCCTGGATCAATAGAGACTGGACGAATAAATGA
TACGAACCCAGGAGAAGCACATTTCTTAGCACAACTTCTTGGTCCTAAAT
ATGAAGGAGAATTGAAAGCACATCCTGAGAAATTAAGCAATGTTATTAAG
AAAGCCTATTTGAACTGTTTTGATGAAGCTCTCAATAACCAAGCCACTGT
GGTCCAAGTGCCTCTGATCTCTTCCTCTATATACTCACCTGGAGGAAAGC
TGGAACTAGAACCCGTAAACCAAACAAAGCCTAATAGCAGTGCATATAAG
CTTTACCACATCCGTACGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy