Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_1 IGR302 IGR301 IGR300 IGR299 IGR295 IGR296 IGR303 IGR297 IGR298 flhA, - CPn0363 fer, - CPn0364 CPn0372 CPn0371 CPn0366 CPn0367 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 flhA, - CPn0363 fer, - CPn0364 CPn0372 CPn0371 CPn0366 CPn0367 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 flhA, - CPn0363 fer, - CPn0364 CPn0371 CPn0366 CPn0365 CPn0370 CPn0369 gcpE, - CPn0373 CPn0368 CPn0367 CPn0372 CPn0368
* Calculated from Protein Sequence

Gene ID: CPn0367

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific conserved hypothetical protein

Gene Start:
413102

Gene Stop:
413839

Gene Length:
738

Molecular Weight*:
26325

pI*:
10.10

Net Charge*:
8.05

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0367 is similar to CT058, a Chlamydia-specific hypothetical protein: residues 28-241 are 23% similar to residues 19-248 of CT058.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0367 is similar to CPn0639, CPn0370 and CPn0107. They are all Chlamydia-specific hypothetical proteins.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
126

PDB Hit:


Gene Protein Sequence:
MTKTTSIPDVHENQSHLSVDERLISESPVLTKKEVIAKIIKLTALILALA
IAVGTAVVAGVLGMPLMAIATGAALLAAVVLSCLLLRRREPSKPTEELLG
PQKHVPKDIAAQVQPSVPLDYQKLLRNEWTLVNTLSEINISWTLQDPNQR
YYVWEHQGAPITLVATTGDIAKPRLKTSGRVMIVNAANSNMQSGGAGTNA
ALSAATHPTCWNNTRTSGGKINTGKGLSVGECRSAPWINRDWTNK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTAAAACCACTTCAATCCCAGATGTACACGAGAATCAATCACATTT
GTCTGTAGATGAGAGATTGATCTCAGAATCACCCGTGCTTACTAAGAAAG
AAGTGATTGCTAAAATAATAAAACTCACAGCTCTTATTCTTGCTTTAGCC
ATAGCTGTAGGGACTGCAGTTGTTGCTGGAGTTCTTGGTATGCCTCTCAT
GGCTATAGCCACTGGTGCTGCTCTCCTTGCAGCAGTCGTACTCTCTTGTC
TTCTTTTAAGAAGAAGAGAGCCATCCAAACCGACAGAAGAGCTCCTTGGG
CCCCAAAAACATGTCCCCAAGGATATTGCAGCTCAAGTGCAACCCTCAGT
CCCTCTGGATTACCAAAAGCTGCTGAGAAATGAATGGACCCTAGTCAATA
CTCTCTCAGAAATCAATATATCCTGGACTCTCCAAGATCCTAATCAAAGA
TACTATGTCTGGGAACATCAAGGAGCCCCAATTACCTTAGTAGCCACTAC
AGGAGACATCGCTAAACCACGCCTGAAAACCTCAGGAAGAGTCATGATTG
TTAACGCAGCGAATTCGAACATGCAATCTGGTGGAGCCGGAACCAATGCT
GCTCTCTCAGCAGCCACACACCCTACTTGTTGGAACAATACGAGAACATC
TGGGGGAAAAATAAACACTGGCAAAGGATTATCTGTGGGTGAATGCCGCT
CAGCACCCTGGATCAATAGAGACTGGACGAATAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy