Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_1 IGR294 IGR301 IGR300 IGR299 IGR295 IGR296 IGR297 IGR298 rpsD, - CPn0362 flhA, - CPn0363 fer, - CPn0364 CPn0371 CPn0366 CPn0367 CPn0365 CPn0370 CPn0369 rpsD, - CPn0362 flhA, - CPn0363 fer, - CPn0364 CPn0371 CPn0366 CPn0367 CPn0365 CPn0370 CPn0369 rpsD, - CPn0362 flhA, - CPn0363 fer, - CPn0364 CPn0366 CPn0365 CPn0370 CPn0369 CPn0368 CPn0367 CPn0371 CPn0368
* Calculated from Protein Sequence

Gene ID: CPn0366

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
411976

Gene Stop:
412443

Gene Length:
468

Molecular Weight*:
16584

pI*:
7.40

Net Charge*:
0.56

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
51  
69
transmembrane  
85  
109

PDB Hit:


Gene Protein Sequence:
MGYLPVSATDVLFESPAAPLINSANTQNQKLIELKGKQQAESSPRTITSV
ILEVLLVIGCCLIVLSLLAIRPALQFTLETGHPAAIAVLAVSGTILLVAV
IILFCFLAAVPFAAKKTYKYVKTVDDYASWHSHQQTPTLGTIFSGIVYAE
SQAQL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGATATCTTCCAGTATCTGCTACGGACGTTCTTTTTGAAAGTCCAGC
CGCTCCCTTAATCAATAGCGCAAACACACAAAATCAGAAACTCATAGAAC
TCAAGGGGAAGCAGCAAGCTGAGTCTTCTCCACGGACAATCACTTCTGTC
ATATTGGAAGTTCTCCTAGTGATCGGATGCTGCCTCATAGTTCTTAGTTT
ATTGGCAATCCGCCCTGCTCTGCAATTCACTCTAGAAACTGGACATCCAG
CTGCCATTGCAGTCCTTGCTGTCTCAGGAACAATTCTATTGGTGGCTGTT
ATCATCTTGTTTTGCTTTCTAGCAGCTGTGCCATTCGCTGCTAAGAAAAC
TTATAAATATGTTAAGACGGTTGATGACTATGCTTCTTGGCATTCTCATC
AGCAAACACCGACCCTAGGCACTATCTTTTCAGGTATCGTCTATGCAGAA
TCCCAGGCGCAATTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy