Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_1 IGR292 IGR294 IGR299 IGR295 IGR296 IGR293 IGR297 IGR298 rpsD, - CPn0362 tyrS, - CPn0361 gnd, - CPn0360 flhA, - CPn0363 fer, - CPn0364 CPn0366 CPn0367 CPn0365 CPn0369 rpsD, - CPn0362 tyrS, - CPn0361 gnd, - CPn0360 flhA, - CPn0363 fer, - CPn0364 CPn0366 CPn0367 CPn0365 CPn0369 Type: tandem, Name:  - 5 rpsD, - CPn0362 tyrS, - CPn0361 gnd, - CPn0360 flhA, - CPn0363 fer, - CPn0364 CPn0366 CPn0365 CPn0369 CPn0368 CPn0367 CPn0368
* Calculated from Protein Sequence

Gene ID: CPn0364

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fer  

Definition:
ferredoxin IV

Gene Start:
409966

Gene Stop:
410241

Gene Length:
276

Molecular Weight*:
10087

pI*:
3.80

Net Charge*:
-16.33

EC:
 

Functional Class:
energy metabolism; electron transport  

Pathway: pathway table

Comment:
Ferredoxins are a group of iron-sulfur proteins
which mediate electron transfer in a wide variety of metabolic
reactions. Ferredoxins can be divided into several subgroups
depending upon the physiological nature of the iron sulfur
cluster(s) and according to sequence similarities.



Blast Summary:  PSI-Blast Search
CPn0364 is orthologously related to CT059, a predicted fer Ferredoxin. Residues 1-91 are 78% similar to CT059.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0633
COG name: Ferredoxin
Functional Class: C
The phylogenetic pattern of COG0633 is A---yq-CE--H------INx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 84 (E-value = 6.3e-14) place CPn0364 in the Fer2 family which is described as 2Fe-2S iron-sulfur cluster binding domain (PF00111)

PDB Hit:


Gene Protein Sequence:
MAKLVITSDDEQQEFELEDNSEIAEPCESMGIPFACTEGVCGTCVIEVLE
GRENLSEFTEPEYDFLGEPEDSNERLACQCRIKGGCVKVTF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCCAAGCTAGTCATTACCTCTGATGATGAACAACAAGAGTTCGAGTT
AGAAGACAATAGTGAGATCGCAGAGCCTTGTGAATCCATGGGCATTCCCT
TTGCTTGTACAGAAGGTGTCTGTGGAACTTGTGTGATAGAGGTCTTAGAA
GGACGTGAGAATCTTTCTGAGTTTACGGAACCAGAATACGATTTTCTAGG
AGAACCCGAAGACTCTAACGAACGTCTTGCTTGTCAGTGCCGCATCAAAG
GTGGCTGTGTCAAAGTTACTTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy