Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_1 IGR292 IGR291 IGR294 IGR295 IGR296 IGR293 IGR297 rpsD, - CPn0362 tyrS, - CPn0361 gnd, - CPn0360 flhA, - CPn0363 fer, - CPn0364 CPn0366 CPn0365 lepA, - CPn0359 rpsD, - CPn0362 tyrS, - CPn0361 gnd, - CPn0360 flhA, - CPn0363 fer, - CPn0364 CPn0366 CPn0365 lepA, - CPn0359 Type: tandem, Name:  - 5 rpsD, - CPn0362 tyrS, - CPn0361 gnd, - CPn0360 flhA, - CPn0363 fer, - CPn0364 CPn0366 CPn0365 lepA, - CPn0359
* Calculated from Protein Sequence

Gene ID: CPn0362

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpsD  

Definition:
RNA polymerase alternative sigma factor, rpsD, sigma 28/WhiG family

Gene Start:
407825

Gene Stop:
407052

Gene Length:
774

Molecular Weight*:
29503

pI*:
5.00

Net Charge*:
-8.10

EC:
 

Functional Class:
transcription; transcription factors  

Pathway: pathway table

Comment:
The sigma factor is an initiation factor that
promotes attachment of the
RNA polymerase to specific initiation sites and then
is released.
In B.subtilis, the alternative sigma factor is
required for transcription of
flagellin and motility genes as well as for wild-type
chemotaxis. For the
sigma-54 sequence, see CT609.
The sigma factor D/WhiG is also similar to other
sigma factors that do not belong to the sigma-54
family.



Blast Summary:  PSI-Blast Search
CPn0362 is orthologously related to CT061: residues 5-255 of CPn0362 are 70% similar to residues 20-251 of CT061, a WhiG-like RNA polymerase alternative sigma factor.
CPn0362 is also similar to CT615, TP0709, UU349.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1191
COG name: Specialized DNA-dependent RNA polymerase sigma subunits including those involved in flagellar operon regulation
Functional Class:  K
The phylogenetic pattern of COG1191 is -----qvceBr-uj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Cpn0362 is paralogous to CPn0756: residues 17-250 of CPn0362 are 27% similar to residues 310-541 of CPn0756, a predicted RNA polymerase Sigma-66.

Pfam Summary:  Pfam Search
Residues 28 to 101 (E-value = 2.6e-18) place CPn0362 in the Sigma70_r2 family which is described as Sigma-70 region 2 (PF04542)
Residues 202 to 251 (E-value = 1.1e-20) place CPn0362 in the Sigma70_r4 family which is described as Sigma-70, region 4 (PF04545)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
180  
257

PDB Hit:


Gene Protein Sequence:
VKTQQTQNIIEVWNFYWETQEIEYRDSLIEFYLPLVKSVVHRLISGMPSH
VKTEDLYASGVEGLVRAVERYNPERSRRFEGYAVFLIKAAIIDDLRKQDW
VPRSVHQKANKLSGAMDSLRQSLGKEPTDLELCEYLNISQQELSGWFVSA
RPALIVSLNEEWPSQSDEGAGMALEERIPDERAETGYDVVDKQEFSLCLA
NAIQELEEKERKVMALYYYEELVLKEIGKVLGVSESRVSQIHSKALLKLR
AALSAFR$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAAACACAGCAAACTCAAAACATCATAGAGGTTTGGAACTTCTACTG
GGAGACTCAGGAAATAGAGTATCGCGATAGCTTAATTGAGTTCTATTTGC
CTTTAGTAAAAAGTGTGGTTCATCGTTTGATTTCAGGGATGCCTTCCCAT
GTAAAGACCGAGGATTTGTATGCTTCGGGTGTTGAAGGTCTCGTCCGTGC
GGTGGAACGTTATAATCCTGAGAGAAGTCGTCGTTTTGAAGGTTATGCGG
TATTTCTGATTAAGGCTGCCATTATTGATGATCTGCGTAAGCAAGACTGG
GTTCCTCGTAGTGTCCATCAAAAAGCGAATAAATTGTCAGGAGCTATGGA
TTCTCTTCGCCAGTCTTTAGGCAAGGAACCCACGGATCTTGAACTGTGTG
AGTATCTCAATATTTCGCAACAAGAGCTTTCGGGATGGTTTGTATCTGCC
CGTCCTGCATTAATCGTGTCTCTGAATGAAGAGTGGCCTTCACAAAGTGA
TGAAGGAGCCGGAATGGCTCTTGAAGAGAGAATCCCCGATGAACGTGCCG
AGACAGGGTACGATGTTGTAGATAAACAAGAATTTTCTTTATGTTTAGCC
AATGCGATTCAGGAACTTGAGGAAAAGGAACGCAAGGTCATGGCCCTGTA
CTACTATGAAGAACTTGTCCTTAAGGAAATCGGTAAGGTCCTTGGGGTAA
GTGAGTCTCGCGTCTCTCAAATTCACTCTAAAGCATTGCTTAAGCTTCGC
GCAGCACTCTCTGCATTTCGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy