Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Pro_1 IGR292 IGR291 IGR294 IGR289 IGR290 IGR295 IGR296 IGR293 CPn0358 rpsD, - CPn0362 CPn0357 tyrS, - CPn0361 gnd, - CPn0360 flhA, - CPn0363 fer, - CPn0364 CPn0365 lepA, - CPn0359 CPn0358 rpsD, - CPn0362 CPn0357 tyrS, - CPn0361 gnd, - CPn0360 flhA, - CPn0363 fer, - CPn0364 CPn0365 lepA, - CPn0359 Type: tandem, Name:  - 5 rpsD, - CPn0362 CPn0357 tyrS, - CPn0361 gnd, - CPn0360 flhA, - CPn0363 CPn0358 fer, - CPn0364 CPn0365 lepA, - CPn0359
* Calculated from Protein Sequence

Gene ID: CPn0361

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tyrS  

Definition:
tyrosyl-tRNA synthetase

Gene Start:
406647

Gene Stop:
405379

Gene Length:
1269

Molecular Weight*:
46947

pI*:
6.00

Net Charge*:
-5.85

EC:
6.1.1.1  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Amino Acid Metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Tyrosyl-tRNA synthetase is a homodimer and is likely to be cytoplasmically located. Through similarity it belongs to class-I aminoacyl-tRNA synthetases.
Reaction: ATP + l-tyrosine + tRNA(tyr) = AMP + pyrophosphate + l-tyrosyl-tRNA(tyr).

Blast Summary:  PSI-Blast Search
CPn0361 is orthologously related to CT062: residues 11-422 of CPn0361 are 61% similar to residues 1-412 of CT062, a predicted tyrosyl-tRNA synthetase from C. trachomatis.
CPn0361 is also similar to UU117, TP0834, MG455.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0162
COG name: Tyrosyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0162 is amtkYqvCeBrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 32 to 324 (E-value = 2.9e-88) place CPn0361 in the tRNA-synt_1b family which is described as tRNA synthetases class I (W and Y) (PF00579)
Residues 356 to 401 (E-value = 2.3e-10) place CPn0361 in the S4 family which is described as S4 domain (PF01479)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
51  
75

PDB Hit:


Gene Protein Sequence:
LAILNYVRSLMQSWLQSLQERNILENFTAGLESVEGPIAAYLGFDPTAPA
LHIGHWIGICFLKRLAALGITPIALVGGATGMVGDPSGKQSERSLLQTSE
VFDNSQKITACLQRYLPGVTLVNNADWLQEISLIDFLGDIGKHFRLGQML
VKDTIKQRVHSDEGISYTEFSYLILQSYDFYHLFKNYGTILQCGGSDQWG
NITSGIDFIRRKGLGQAYGLTYPLLTNAQGKKIGKTESGTVWLDSDLTSP
FELYQYLLRLPDDTIPKIARTLTLLSNEEIQDIDRRVQTDPVAVKEFVAQ
DILSAIHGDLGLEEALSVTRSMHPGNLSSLSEKDFHELFAGGMGASLDKS
EVLGKRWLDLFLVLGLCKSKGEIRRLIEQKGVYINNVPIANEHSVCEEQD
ICYGHYVLLAQGKKRKLVLYLN$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGCAATTCTTAATTATGTACGATCACTCATGCAATCCTGGTTACAATC
TTTACAAGAGCGAAATATTTTAGAGAATTTTACCGCAGGTTTGGAATCCG
TAGAGGGACCTATCGCCGCTTATTTAGGATTTGATCCTACCGCACCTGCT
CTACATATTGGTCATTGGATTGGGATTTGTTTCTTGAAGAGACTCGCTGC
TCTGGGGATTACCCCCATAGCTTTAGTCGGGGGAGCCACAGGTATGGTTG
GAGATCCCTCAGGGAAACAGAGCGAGAGATCGTTACTTCAGACAAGTGAA
GTTTTTGATAACAGTCAAAAGATCACGGCGTGTCTCCAGCGCTATCTTCC
CGGGGTGACTCTTGTAAATAATGCAGACTGGTTGCAGGAGATCTCCCTGA
TTGATTTCTTAGGGGATATAGGAAAACACTTTCGTTTAGGCCAAATGCTA
GTGAAAGATACAATAAAGCAGCGGGTGCATTCTGATGAAGGAATTAGCTA
TACCGAGTTTAGCTATTTAATCCTGCAATCCTATGATTTTTATCACTTAT
TTAAAAATTATGGCACGATCTTGCAGTGCGGTGGTAGCGATCAGTGGGGG
AATATTACTTCAGGAATCGATTTTATTCGCCGTAAAGGGTTGGGTCAGGC
CTACGGCCTTACCTATCCTTTATTAACGAATGCTCAGGGGAAAAAAATAG
GGAAAACAGAGTCGGGAACTGTATGGCTCGATTCAGATTTAACCTCTCCT
TTTGAGCTGTACCAATACTTACTCCGTTTGCCCGATGATACCATCCCTAA
AATTGCTCGTACGTTAACTTTATTGAGCAATGAAGAAATTCAAGATATTG
ATAGGCGTGTACAGACGGATCCAGTTGCAGTGAAGGAATTTGTAGCCCAA
GATATCTTAAGTGCTATTCATGGAGATCTAGGGCTTGAAGAGGCTCTTTC
TGTAACTCGTAGCATGCATCCAGGGAATCTTTCATCCTTATCGGAAAAAG
ATTTTCATGAATTGTTTGCAGGAGGGATGGGGGCCTCATTGGATAAATCC
GAGGTGTTAGGGAAACGTTGGTTAGACCTATTTCTTGTTTTGGGACTATG
TAAATCTAAAGGGGAAATTCGAAGGCTAATTGAACAAAAAGGGGTATATA
TTAATAATGTGCCCATCGCTAATGAGCATAGTGTTTGTGAAGAACAAGAC
ATCTGTTATGGTCACTATGTGTTGTTGGCTCAAGGTAAAAAACGAAAGCT
TGTTCTATATTTAAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy