Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR288 IGR292 IGR291 IGR294 IGR287 IGR289 IGR290 IGR293 CPn0358 CPn0356 rpsD, - CPn0362 CPn0357 tyrS, - CPn0361 CPn0355 gnd, - CPn0360 flhA, - CPn0363 lepA, - CPn0359 CPn0358 CPn0356 rpsD, - CPn0362 CPn0357 tyrS, - CPn0361 CPn0355 gnd, - CPn0360 flhA, - CPn0363 lepA, - CPn0359 Type: tandem, Name:  - 5 CPn0358 rpsD, - CPn0362 CPn0357 tyrS, - CPn0361 CPn0355 gnd, - CPn0360 flhA, - CPn0363 CPn0356 lepA, - CPn0359
* Calculated from Protein Sequence

Gene ID: CPn0360

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gnd  

Definition:
6-phosphogluconate dehydrogenase

Gene Start:
405358

Gene Stop:
403919

Gene Length:
1440

Molecular Weight*:
52910

pI*:
6.50

Net Charge*:
-4.12

EC:
1.1.1.44  

Functional Class:
energy metabolism; pentose phosphate pathway  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle

Comment:
6-phosphogluconate dehydrogenase catalyzes the
third step in the
hexose monophosphate shunt, the decarboxylating
reduction of
6-phosphogluconate to ribulose 5-phosphate.

Blast Summary:  PSI-Blast Search
CPn0360 is similar to TP0331, also a predicted
phosphogluconate dehydrogenase in T. pallidum:
residues 4-475 are 48% similar to TP0331.

CPn0360 is orthologously related to CT063:
residues 3-476 are 65% similar to residues
5-480 of CT063.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0362
COG name: 6-phosphogluconate dehydrogenase, family 1
Functional Class:  G
The phylogenetic pattern of COG0362 is ----Y-vceBrh----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 174 (E-value = 7e-118) place CPn0360 in the NAD_binding_2 family which is described as NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446)
Residues 176 to 470 (E-value = 1.5e-142) place CPn0360 in the 6PGD family which is described as 6-phosphogluconate dehydrogenase, C-terminal domain (PF00393)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
199  
216
transmembrane  
272  
289
transmembrane  
319  
336
transmembrane  
358  
375
transmembrane  
413  
430

PDB Hit:


Gene Protein Sequence:
LQTNIGLIGLAVMGKNLVLNMIDHGFSVSVYNRTPEKTRDFLKEYPNHRE
LVGFESLEDFVNSLERPRKIMLMIQAGKPVDQSIHALLPFLEPGDVIIDG
GNSYFKDSERRCKELQEKGILFLGVGISGGEEGARHGPSIMPGGNPEAWP
LVAPIFQSIAAKVQGRPCCSWVGTGGAGHYVKAVHNGIEYGDIQLICEAY
GILRDFLKLSATAVATILKEWNTLELESYLIRIASEVLALKDPEGIPVID
TILDVVGQKGTGKWTAIDALNSGVPLSLIIGAVLARFLSSWKEIREQAAR
NYPGTPLIFEMPHDPSVFIQDVFHALYASKIISYAQGFMLLGEASKEYNW
GLDLGEIALMWRGGCIIQSAFLDVIHKGFAANPENTSLIFQEYFRGALRH
AEMGWRRTVVTAIGAGLPIPCLAAAITFYDGYRTASSSMSLAQGLRDYFG
AHTYERNDRPRGEFYHTDWVHTKTTERVK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCAAACGAATATTGGTCTTATTGGCTTAGCTGTCATGGGGAAAAATCT
TGTCTTAAACATGATAGATCATGGTTTTTCTGTCTCTGTCTATAATCGGA
CCCCAGAGAAAACGCGGGACTTCTTGAAAGAATACCCTAACCACCGAGAG
CTTGTAGGGTTTGAATCTTTAGAAGATTTTGTGAATTCATTGGAGAGACC
ACGAAAGATCATGTTGATGATTCAAGCAGGGAAACCTGTGGATCAGAGCA
TTCATGCGTTACTGCCTTTTCTAGAACCCGGCGATGTGATTATCGATGGG
GGGAATAGCTATTTTAAAGATTCCGAACGACGATGTAAAGAGTTGCAAGA
AAAGGGGATTCTCTTCTTAGGCGTGGGGATTTCTGGAGGAGAAGAAGGTG
CACGTCACGGCCCATCAATTATGCCTGGAGGAAATCCTGAGGCGTGGCCA
TTAGTGGCTCCTATTTTTCAATCAATAGCAGCAAAAGTACAGGGCCGTCC
CTGCTGTTCTTGGGTAGGAACTGGCGGTGCAGGCCACTATGTAAAGGCTG
TTCACAATGGTATAGAATACGGCGATATCCAGTTGATATGCGAAGCTTAC
GGTATCTTAAGAGATTTCCTAAAGCTCTCCGCAACTGCCGTTGCTACAAT
TTTGAAAGAGTGGAATACTCTAGAGTTGGAAAGCTATCTAATTCGTATTG
CTTCTGAAGTCCTAGCATTGAAAGATCCGGAAGGAATCCCTGTTATTGAT
ACGATTTTAGATGTCGTGGGCCAAAAAGGTACAGGAAAGTGGACCGCAAT
CGATGCTTTAAATTCTGGAGTTCCCCTTTCCTTAATCATAGGAGCTGTTC
TTGCTCGTTTCCTTTCTTCTTGGAAAGAGATACGCGAGCAAGCTGCCCGT
AATTATCCAGGAACCCCCTTAATATTTGAAATGCCCCATGATCCCTCGGT
ATTCATACAAGATGTCTTTCATGCTTTATACGCTTCCAAGATCATCAGCT
ATGCTCAGGGATTCATGCTTTTAGGAGAAGCTTCAAAAGAATATAATTGG
GGATTAGACCTAGGAGAAATTGCTTTGATGTGGCGCGGGGGATGCATTAT
TCAAAGTGCATTTTTAGATGTTATACATAAAGGATTTGCTGCCAACCCAG
AGAATACCTCGCTCATCTTCCAAGAATATTTCCGTGGAGCATTACGCCAT
GCGGAGATGGGATGGCGTAGAACAGTAGTGACTGCAATTGGTGCAGGGCT
ACCTATTCCCTGTTTAGCAGCAGCAATCACGTTTTATGATGGCTATCGTA
CAGCAAGCTCTTCAATGTCGTTAGCTCAAGGACTGCGAGATTATTTTGGA
GCTCATACCTACGAGCGTAACGATCGCCCTCGAGGAGAGTTCTATCATAC
CGATTGGGTGCACACGAAAACTACAGAAAGAGTGAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy