Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR288 IGR292 IGR286 IGR291 IGR294 IGR287 IGR289 IGR290 IGR293 CPn0358 CPn0356 rpsD, - CPn0362 CPn0357 tyrS, - CPn0361 CPn0355 gnd, - CPn0360 CPn0354 lepA, - CPn0359 CPn0358 CPn0356 rpsD, - CPn0362 CPn0357 tyrS, - CPn0361 CPn0355 gnd, - CPn0360 CPn0354 lepA, - CPn0359 Type: tandem, Name:  - 5 CPn0358 rpsD, - CPn0362 CPn0357 tyrS, - CPn0361 CPn0355 gnd, - CPn0360 CPn0356 CPn0354 lepA, - CPn0359
* Calculated from Protein Sequence

Gene ID: CPn0359

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lepA  

Definition:
GTP-binding protein (possible membrane protein)

Gene Start:
402012

Gene Stop:
403820

Gene Length:
1809

Molecular Weight*:
67259

pI*:
6.50

Net Charge*:
-3.43

EC:
 

Functional Class:
cellular processes; standard protein secretion  
uncategorized  

Pathway: pathway table

Comment:
A cytoplasmic membrane protein in E.coli that shows similarity to GTP-binding elongation factors.

Blast Summary:  PSI-Blast Search
Cpn0359 is similar to CT064, CT437, CT322, and CT096. CT064 is a predicted lepA GTP-binding membrane protein. Residues 1-602 are 89% similar to CT064.
Numerous significant hits in gapped BLAST to GTP-binding protein LEPA sequences; e.g. 2-602 are 50% similar to LEPA_BACSU; residues 1-602 are 50% similar to LEPA_SYNY3; residues 6-599 are 46% similar to LEPA_ECOLI; residues 9-599 are 53% similar to UU324; residues 6-600 are 50% similar to TP0510; and residues 7-600 are 47% similar to MG138.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0481
COG name: Membrane GTPase LepA
Functional Class:  N
The phylogenetic pattern of COG0481 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 11-22, 80-111, and 206-219 represent blocks BL00301A-C (GTP-binding elongation factors proteins) with a combined E-value of 7e-26.

ProDom Summary:  Protein Domain Search
Residues 21-184 are 61% similar to a defined domain of O67618_AQUAE, defined as: PROTEIN GTP-BINDING LIPOPROTEIN PRENYLATION TRANSPORT FACTOR RAS-RELATED ELONGATION ADP-RIBOSYLATION BIOSYNTHESIS.
Residues 487-600 are 57% similar to a defined domain of LEPA_BACSU, defined as: GTP-BINDING PROTEIN LEPA MEMBRANE GUF1 GTPASE BIOSYNTHESIS G-PROTEIN PUTATIVE C1B3.04C.
Residues 348-477 are 46% similar to a defined domain of LEPA_ECOLI, defined as: ELONGATION FACTOR PROTEIN GTP-BINDING BIOSYNTHESIS EF-2 RESISTANCE PHOSPHORYLATION G EF-G.

Paralogs:  Local Blast Search
CPn0550, CPn0317, and CPn0074 are all possible paralogs. Residues 2-156 are 36% similar to CPn0550.

Pfam Summary:  Pfam Search
Residues 7 to 188 (E-value = 5.5e-71) place CPn0359 in the GTP_EFTU family which is described as Elongation factor Tu GTP binding domain (PF00009)
Residues 209 to 281 (E-value = 1e-11) place CPn0359 in the GTP_EFTU_D2 family which is described as Elongation factor Tu domain 2 (PF03144)
Residues 404 to 493 (E-value = 1.7e-30) place CPn0359 in the EFG_C family which is described as Elongation factor G C-terminus (PF00679)
Residues 494 to 602 (E-value = 5.3e-74) place CPn0359 in the LepA_C family which is described as GTP-binding protein LepA C-terminus (PF06421)

PDB Hit:


Gene Protein Sequence:
LKEYKIENIRNFSIIAHIDHGKSTIADRLLESTSTVEEREMREQLLDSMD
LERERGITIKAHPVTMTYLYEGEVYQLNLIDTPGHVDFSYEVSRSLSACE
GALLIVDAAQGVQAQSLANVYLALERDLEIIPVLNKIDLPAADPVRIAQQ
IEDYIGLDTTNIIACSAKTGQGIPAILKAIIDLVPPPKAPAETELKALVF
DSHYDPYVGIMVYVRIISGELKKGDRITFMAAKGSSFEVLGIGAFLPKAT
FIEGSLRPGQVGFFIANLKKVKDVKIGDTVTKTKHPAKTPLEGFKEINPV
VFAGIYPIDSSDFDTLKDALGRLQLNDSALTIEQESSHSLGFGFRCGFLG
LLHLEIIFERIIREFDLDIIATAPSVIYKVVLKNGKVLDIDNPSGYPDPA
IIEHVEEPWVHVNIITPQEYLSNIMNLCLDKRGICVKTEMLDQHRLVLAY
ELPLNEIVSDFNDKLKSVTKGYGSFDYRLGDYRKGSIIKLEVLINEEPID
AFSCLVHRDKAESRGRSICEKLVDVIPQQLFKIPIQAAINKKVIARETIR
ALSKNVTAKCYGGDITRKRKLWEKQKKGKKRMKEFGKVSIPNTAFIEVLK
LD$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAAAGAATATAAGATAGAGAACATTCGCAATTTTTCAATCATAGCGCA
TATTGATCACGGGAAGTCTACAATTGCTGATCGCCTTTTAGAAAGTACGA
GCACAGTAGAAGAACGGGAGATGCGTGAGCAGCTCTTAGATTCCATGGAT
CTTGAAAGAGAGCGTGGCATTACAATTAAAGCTCATCCTGTCACCATGAC
GTATCTATATGAAGGAGAGGTGTATCAACTGAACCTGATTGATACCCCTG
GTCACGTGGACTTTTCGTATGAAGTCTCTCGATCTCTATCTGCATGTGAG
GGCGCCTTACTTATTGTAGATGCCGCCCAGGGGGTGCAGGCACAAAGTCT
TGCTAATGTCTACCTGGCCCTTGAAAGAGATTTAGAGATCATTCCTGTAT
TAAACAAGATTGATCTACCTGCCGCTGATCCCGTGAGAATTGCTCAACAG
ATTGAAGATTATATAGGCCTAGACACTACGAACATTATTGCCTGTTCTGC
AAAAACAGGTCAGGGGATCCCTGCAATCCTGAAAGCAATTATCGATCTTG
TTCCTCCTCCAAAAGCACCTGCAGAAACAGAGCTTAAAGCTTTAGTCTTT
GATTCTCATTATGACCCTTACGTTGGCATTATGGTCTACGTACGCATTAT
TAGCGGGGAATTAAAAAAAGGAGACCGCATTACTTTTATGGCGGCTAAAG
GCTCCTCGTTTGAAGTCTTAGGTATAGGGGCCTTTCTCCCTAAAGCAACA
TTTATAGAAGGTTCCTTACGCCCTGGTCAGGTGGGTTTTTTTATTGCCAA
TCTCAAAAAAGTGAAGGATGTGAAGATCGGCGATACAGTCACGAAAACAA
AACATCCTGCAAAAACTCCTTTGGAAGGCTTCAAAGAGATCAATCCGGTA
GTTTTTGCTGGAATTTATCCTATAGATTCTTCTGATTTTGATACTTTGAA
AGATGCTTTAGGAAGACTACAGCTCAATGATTCTGCTTTAACTATAGAAC
AAGAAAGCAGTCACTCTTTAGGCTTTGGTTTTCGTTGTGGCTTCTTAGGA
CTTCTTCATCTTGAGATTATCTTTGAAAGAATCATTCGAGAATTTGACTT
AGATATTATTGCAACGGCTCCAAGTGTCATCTATAAAGTCGTCTTAAAAA
ACGGGAAAGTTCTAGATATTGATAACCCCTCAGGATATCCGGATCCTGCG
ATCATCGAGCATGTGGAAGAGCCTTGGGTTCATGTGAATATTATCACCCC
TCAAGAATATCTGAGCAACATTATGAACCTCTGTTTAGATAAACGTGGGA
TCTGCGTAAAAACAGAAATGCTAGATCAGCACCGTCTAGTTCTTGCTTAC
GAACTCCCTTTAAATGAGATTGTCTCGGATTTCAATGACAAGCTGAAGTC
AGTAACTAAAGGTTATGGATCCTTTGACTACCGTCTTGGGGATTACCGTA
AGGGATCGATCATCAAATTAGAGGTTCTTATTAACGAGGAGCCCATAGAT
GCTTTTTCTTGTTTAGTCCATAGAGATAAAGCAGAATCTCGTGGAAGAAG
TATCTGCGAAAAGCTTGTGGACGTGATTCCACAACAACTCTTCAAGATTC
CCATCCAAGCTGCCATTAACAAAAAAGTCATTGCCAGAGAAACGATTCGT
GCGCTTTCTAAGAACGTGACCGCAAAGTGTTATGGCGGAGATATTACTAG
GAAACGCAAGCTGTGGGAAAAGCAAAAGAAAGGAAAAAAACGTATGAAGG
AATTTGGAAAAGTTTCCATTCCCAATACAGCTTTCATTGAAGTTCTAAAA
TTAGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy