Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR288 IGR285 IGR284 IGR286 IGR291 IGR283 IGR287 IGR289 IGR290 CPn0358 CPn0356 CPn0357 CPn0355 gnd, - CPn0360 CPn0353 CPn0352 CPn0354 adt, - CPn0351 lepA, - CPn0359 CPn0358 CPn0356 CPn0357 CPn0355 gnd, - CPn0360 CPn0353 CPn0352 CPn0354 adt, - CPn0351 lepA, - CPn0359 CPn0358 CPn0357 CPn0355 gnd, - CPn0360 CPn0356 CPn0353 CPn0352 CPn0354 adt, - CPn0351 lepA, - CPn0359
* Calculated from Protein Sequence

Gene ID: CPn0356

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
400459

Gene Stop:
400106

Gene Length:
354

Molecular Weight*:
14057

pI*:
5.00

Net Charge*:
-5.14

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
VQLFQYMNESGWDWLCDFDSQGEGFQLSRLVGLLHSSWALYEAKEQFYLP
EVSLLTWEELIEMQLLSKPTKHGVAKDLCNVFEKHFQRFRQYLGSLDLNQ
RFENTFLNYPKYHLDRE$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCAATTATTTCAATATATGAATGAGTCCGGATGGGATTGGCTTTGTGA
TTTTGATTCTCAAGGCGAGGGATTCCAGTTATCACGTCTGGTTGGGCTGT
TACATTCGTCCTGGGCATTATACGAAGCAAAAGAGCAATTTTACCTTCCT
GAGGTTTCTCTATTGACCTGGGAAGAACTGATAGAAATGCAGTTATTAAG
CAAACCAACAAAACACGGGGTTGCAAAAGATCTTTGTAATGTATTTGAAA
AACACTTTCAAAGGTTTAGACAGTACCTAGGTTCCTTAGATCTAAATCAA
AGGTTCGAAAATACCTTCTTGAATTATCCTAAATACCATTTAGATAGGGA
GTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy