Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR288 IGR285 IGR284 IGR286 IGR283 IGR282 IGR287 IGR289 IGR290 IGR281 CPn0358 CPn0356 CPn0357 CPn0355 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 lepA, - CPn0359 CPn0358 CPn0356 CPn0357 CPn0355 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 lepA, - CPn0359 CPn0358 CPn0357 CPn0355 CPn0356 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 lepA, - CPn0359
* Calculated from Protein Sequence

Gene ID: CPn0354

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
397167

Gene Stop:
398510

Gene Length:
1344

Molecular Weight*:
50607

pI*:
8.00

Net Charge*:
5.10

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Few significant hits to hypothetical proteins in C.pneumoniae:

Residues 1-395 are 25% similar to residues 3-359 of CPn0355.
Residues 9-347 are 22% similar to residues 14-299 of CPn0352.
Residues 1-328 are 22% similar to residues 1-283 of CPn0357.

Pfam Summary:  Pfam Search
Residues 2 to 395 (E-value = 1.5e-290) place CPn0354 in the DUF1389 family which is described as Protein of unknown function (DUF1389) (PF07146)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
74

PDB Hit:


Gene Protein Sequence:
MSNITSPVIQNNRSCNYYFELKNSTTIHIVISAILLCGALIAFLCVAAPV
SYILSGALLGLGLLIALIGVILGIKKITPMISSKEQVFPQELVNRIRAHY
PKFVSDFVSEAKPNLKDLISFIDLLNQLHSEVGSSTNYNVSEELQQKIDT
FEGIARLKNEVRTASLKRLESAASSRPLFPSLPKILQKVFPFFWLGEFIS
AGSKVVELHRVKKIGGSLEEDLSDYIKPEMLPTYWLIPLDFRPTNSSILN
LHTLVLARVLTRDVFQHLKYAALNGEWNLNHSDLNTMKQQLFAKYHAAYQ
SYKHLSQPSLQEDEFYNLLLCIFKHRYSWKQMSLIKTVPADLWENLCCLT
LDHTGRPQDMEFASLIGTLYTQGLIHKESEAFLSSLTLLSLDQFKTIRRQ
STNIAMFLENLATHNSTFRSLPPITVHPLKRSVFSQPEEDESSLLIG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAATATAACCTCGCCAGTTATTCAAAATAATCGCTCTTGTAATTA
TTATTTTGAATTAAAGAATTCAACCACTATTCATATTGTTATCAGTGCCA
TCTTACTCTGCGGAGCTTTGATAGCTTTCTTGTGTGTAGCAGCTCCTGTT
TCCTATATTCTAAGTGGCGCATTGTTAGGATTAGGATTATTAATAGCCTT
GATTGGTGTGATTTTAGGAATAAAAAAAATCACGCCTATGATTTCATCAA
AAGAACAAGTATTCCCCCAAGAACTCGTAAATAGAATCAGGGCGCACTAT
CCTAAATTTGTCTCTGATTTTGTTTCAGAAGCTAAACCAAATCTTAAAGA
TCTCATAAGTTTTATTGATCTTCTAAATCAATTGCACTCTGAAGTTGGAT
CATCTACAAATTACAACGTATCTGAAGAACTACAACAGAAAATAGATACG
TTCGAGGGTATCGCACGCTTAAAAAATGAAGTCCGTACTGCTTCTCTTAA
AAGACTTGAAAGCGCTGCTTCTTCCCGTCCCCTCTTCCCCTCTTTACCAA
AAATCTTACAAAAGGTATTTCCATTTTTCTGGTTAGGAGAGTTTATTTCT
GCAGGCAGCAAGGTTGTAGAGCTCCATCGAGTTAAGAAAATTGGAGGCAG
CCTCGAAGAAGACCTTAGTGATTATATAAAACCAGAGATGCTTCCTACCT
ATTGGTTGATTCCTTTAGATTTTAGACCAACAAATTCCTCTATTCTAAAT
CTACACACATTAGTTTTAGCTAGAGTCTTAACTCGTGATGTTTTTCAACA
TCTTAAGTATGCAGCATTAAATGGCGAGTGGAACCTGAATCATAGTGATC
TAAATACTATGAAACAGCAGCTCTTTGCTAAATATCATGCGGCGTATCAA
TCCTATAAACATCTATCTCAACCCTCTCTTCAAGAGGATGAATTCTATAA
CCTGCTCTTGTGTATTTTTAAGCATAGGTACTCGTGGAAGCAGATGTCCT
TAATAAAAACAGTCCCGGCTGATTTATGGGAAAACCTCTGTTGCTTGACT
TTAGACCATACAGGACGACCCCAAGACATGGAATTTGCCTCTCTAATTGG
TACTCTCTACACACAAGGCCTAATTCATAAAGAAAGCGAAGCATTTCTTT
CTTCATTGACACTCCTTAGTTTAGATCAGTTTAAAACGATCCGTCGTCAG
TCAACCAATATAGCGATGTTCCTTGAGAATTTAGCAACTCATAATTCCAC
CTTTAGAAGCTTACCACCTATAACAGTCCATCCACTCAAGAGAAGCGTCT
TCTCCCAACCTGAAGAAGACGAGTCCTCCCTGCTGATAGGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy