Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR288 IGR285 IGR284 IGR286 IGR283 IGR282 IGR287 IGR281 CPn0356 CPn0357 ytgA,troA,adhS, - CPn0349 CPn0355 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 CPn0356 CPn0357 ytgA,troA,adhS, - CPn0349 CPn0355 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 CPn0357 ytgA,troA,adhS, - CPn0349 CPn0355 ytgB_1,troB, - CPn0348 ytgB_1,troB, - CPn0348 CPn0356 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351
* Calculated from Protein Sequence

Gene ID: CPn0352

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
395574

Gene Stop:
396833

Gene Length:
1260

Molecular Weight*:
47763

pI*:
9.40

Net Charge*:
14.90

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
No apparent similarity to C.trachomatis.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae. No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae:

Residues 6-353 are 28% similar to residues 3-368 of CPn0355.
Residues 31-280 are 24% similar to residues 28-283 of CPn0357.
Residues 14-299 are 22% similar to residues 9-347 of CPn0354.

Pfam Summary:  Pfam Search
Residues 7 to 344 (E-value = 1.4e-233) place CPn0352 in the DUF1389 family which is described as Protein of unknown function (DUF1389) (PF07146)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
89

PDB Hit:


Gene Protein Sequence:
MKCSPLTLVPHIFLKNDCECHRSCSLKIRTIARLILGLVLALVSALSFVF
LAAPISYAIGGTLALAAIVILIITLVVALLAKSKVLPIPNELQKIIYNRY
PKEVFYFVKTHSLTVNELKIFINCWKSGTDLPPNLHKKAEAFGIDILKSI
DLTLFPEFEEILLQNCPLYWLSHFIDKTESVAGEIGLNKTQKVYGLLGPL
AFHKGYTTIFHSYTRPLLTLISESQYKFLYSKASKNQWDSPSVKKTCEEI
FKELPHNMIFRKDVQGISQFLFLFFSHGITWEQAQMIQLINPDNWKMLCQ
FDKAGGHCSMATFGGFLNTETNMFDPVSSNYEPTVNFMTWKELKVLLEKV
KESPMHPASALVQKICVNTTHHQNLLKRWQFVRNTSSQWTSSLPQYAFHA
QTYKLEKKIESSLPIRSSL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTGTAGTCCTTTAACACTAGTTCCCCATATATTTTTAAAAAATGA
CTGCGAATGTCATAGATCTTGTTCTTTAAAAATTAGGACAATTGCCCGAC
TCATTCTTGGGCTTGTTCTAGCTCTTGTTAGCGCACTTTCTTTTGTTTTC
CTTGCTGCGCCGATTAGCTATGCTATTGGAGGAACTTTAGCTTTAGCCGC
TATCGTAATCTTGATTATAACGCTAGTCGTAGCACTGCTAGCTAAATCAA
AGGTTCTGCCCATCCCCAACGAACTTCAGAAGATTATTTACAATCGCTAT
CCTAAAGAAGTCTTTTATTTCGTGAAAACACACTCCCTGACTGTTAACGA
ATTAAAAATATTTATTAATTGCTGGAAAAGCGGTACAGACCTGCCTCCGA
ATTTACATAAAAAAGCAGAGGCTTTCGGGATCGATATTCTAAAATCTATA
GATTTAACCCTGTTTCCAGAGTTCGAAGAGATTCTTCTTCAAAACTGCCC
GTTATACTGGCTCTCCCATTTTATAGACAAAACTGAATCTGTTGCTGGGG
AAATCGGATTAAATAAAACACAAAAAGTTTATGGTTTACTTGGGCCCTTA
GCGTTTCATAAAGGATATACAACTATTTTCCACTCTTATACACGCCCTCT
ACTAACATTAATCTCAGAATCACAGTATAAGTTCCTATATAGTAAAGCGT
CTAAGAATCAATGGGATTCTCCTTCTGTGAAAAAAACCTGCGAAGAAATA
TTCAAGGAACTCCCCCACAATATGATTTTCCGGAAGGATGTTCAAGGAAT
CTCACAATTCTTATTTCTTTTCTTTTCTCATGGTATCACTTGGGAACAGG
CTCAGATGATTCAACTTATAAATCCTGATAATTGGAAAATGTTGTGTCAG
TTTGATAAAGCAGGAGGCCACTGTTCCATGGCAACATTTGGAGGCTTTTT
GAATACTGAAACAAATATGTTCGATCCAGTATCCTCTAACTATGAACCTA
CAGTGAACTTCATGACGTGGAAAGAATTGAAGGTTTTACTAGAGAAAGTA
AAAGAAAGTCCTATGCACCCAGCGAGTGCTCTTGTTCAGAAGATATGCGT
AAATACAACGCACCATCAAAATCTGTTAAAACGATGGCAATTTGTTCGTA
ATACGAGTTCACAATGGACATCAAGCTTACCTCAGTATGCTTTCCACGCC
CAAACCTACAAACTAGAGAAAAAAATAGAAAGCAGTCTCCCTATACGATC
TTCCCTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy