Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR280 IGR285 IGR284 IGR286 IGR283 IGR282 IGR281 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 CPn0355 ytgC,troC, - CPn0347 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 CPn0355 ytgC,troC, - CPn0347 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 CPn0355 ytgC,troC, - CPn0347 ytgB_1,troB, - CPn0348 ytgB_1,troB, - CPn0348 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351
* Calculated from Protein Sequence

Gene ID: CPn0351

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
adt  

Definition:
ATP/ADP translocase (Npt1)

Gene Start:
393888

Gene Stop:
395435

Gene Length:
1548

Molecular Weight*:
57188

pI*:
10.30

Net Charge*:
16.78

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:
See Tjaden et al., J. Bact. 181:1196,1999.

Blast Summary:  PSI-Blast Search
CPn0351 is similar to CT065 (orthologously related) and CT495 (paralogously related), both predicted adt ADP/ATP translocases (carrier proteins). Residues 1-511 are 79% similar to CT065.
No similarity to T.pallidum, U. urealyticum or M.genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0351 is paralogously related to CPn0614, a predicted riboside triphosphate
translocase.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
27  
44
transmembrane  
65  
85
transmembrane  
96  
113
transmembrane  
139  
162
transmembrane  
187  
204
transmembrane  
226  
243
transmembrane  
286  
303
transmembrane  
331  
348
transmembrane  
360  
377
transmembrane  
388  
405
transmembrane  
465  
486

PDB Hit:


Gene Protein Sequence:
MTKTEEKPFGKLRSFLWPIHTHELKKVLPMFLMFFCITFNYTVLRDTKDT
LIVGAPGSGAEAIPFIKFWLVVPCAIIFMLIYAKLSNILSKQALFYAVGT
PFLIFFALFPTVIYPLRDVLHPTEFADRLQAILPPGLLGLVAILRNWTFA
AFYVLAELWGSVMLSLMFWGFANEITKIHEAKRFYALFGIGANISLLASG
RAIVWASKLRASVSEGVDPWGISLRLLMAMTIVSGLVLMASYWWINKNVL
TDPRFYNPEEMQKGKKGAKPKMNMKDSFLYLARSPYILLLALLVIAYGIC
INLIEVTWKSQLKLQYPNMNDYSEFMGNFSFWTGVVSVLIMLFVGGNVIR
KFGWLTGALVTPVMVLLTGIVFFALVIFRNQASGLVAMFGTTPLMLAVVV
GAIQNILSKSTKYALFDSTKEMAYIPLDQEQKVKGKAAIDVVAARFGKSG
GALIQQGLLVICGSIGAMTPYLAVILLFIIAIWLVSATKLNKLFLAQSAL
KEQEVAQEDSAPASS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAAAAACCGAAGAAAAACCTTTTGGAAAATTGCGCTCTTTCTTGTG
GCCGATACATACTCACGAGCTAAAGAAAGTTCTGCCAATGTTCCTAATGT
TCTTCTGTATTACATTTAACTATACGGTGTTACGCGATACAAAAGACACT
CTTATTGTGGGAGCTCCTGGTTCTGGTGCAGAGGCAATACCTTTCATCAA
GTTTTGGCTTGTTGTCCCCTGTGCTATTATCTTTATGCTTATTTATGCAA
AGCTAAGTAATATTTTAAGTAAGCAGGCCTTATTTTATGCAGTGGGAACG
CCCTTTTTAATTTTCTTTGCCCTGTTCCCGACTGTAATTTATCCGCTACG
CGATGTTTTACATCCTACAGAATTTGCTGACCGTTTACAGGCCATCCTAC
CTCCAGGATTGCTAGGACTCGTTGCCATCTTAAGAAACTGGACATTTGCT
GCATTTTATGTACTTGCTGAACTATGGGGAAGCGTCATGCTATCTCTAAT
GTTCTGGGGATTTGCTAATGAAATTACAAAAATCCACGAAGCAAAGCGTT
TCTACGCTCTTTTCGGTATCGGAGCTAATATTTCTTTACTAGCTTCTGGT
CGTGCAATTGTTTGGGCTTCAAAGTTGAGAGCTTCCGTTTCTGAAGGTGT
AGATCCTTGGGGAATTTCTTTACGTCTTTTGATGGCTATGACTATTGTAT
CTGGACTTGTTCTTATGGCCAGTTACTGGTGGATCAATAAGAACGTATTG
ACCGATCCTCGCTTCTATAATCCAGAAGAAATGCAAAAGGGGAAAAAAGG
TGCTAAACCTAAAATGAATATGAAAGATAGCTTCCTCTATCTTGCTAGAT
CTCCTTATATTCTTTTATTAGCTCTCTTGGTTATTGCCTATGGTATTTGC
ATTAACTTAATCGAAGTGACTTGGAAAAGTCAGCTGAAACTGCAATATCC
TAATATGAATGACTATAGTGAGTTCATGGGGAACTTCTCCTTCTGGACTG
GCGTAGTATCCGTACTTATCATGCTATTTGTTGGTGGTAACGTCATTCGT
AAATTTGGATGGTTAACTGGAGCCCTAGTCACTCCTGTCATGGTTCTCCT
AACAGGTATCGTTTTCTTCGCTCTTGTTATCTTTAGAAACCAAGCTTCTG
GGCTGGTCGCTATGTTCGGTACAACTCCTCTCATGCTAGCTGTGGTTGTC
GGAGCTATACAGAATATTCTTTCGAAATCCACAAAATACGCTCTCTTTGA
CTCAACTAAAGAAATGGCCTATATCCCTCTTGACCAAGAGCAAAAAGTCA
AAGGTAAGGCTGCTATTGATGTAGTTGCTGCCCGCTTCGGAAAATCAGGA
GGAGCTTTAATCCAACAAGGTTTGCTCGTTATCTGTGGAAGTATTGGAGC
TATGACCCCTTATCTTGCAGTGATTCTTCTTTTCATCATTGCTATTTGGT
TGGTTTCTGCAACTAAGTTAAACAAACTATTCTTAGCGCAGTCTGCTCTT
AAAGAACAAGAAGTGGCTCAAGAAGATTCAGCTCCTGCTTCTTCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy