Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR280 IGR285 IGR284 IGR279 IGR283 IGR282 IGR281 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 ytgB_1,troB, - CPn0348 ytgB_1,troB, - CPn0348 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351
* Calculated from Protein Sequence

Gene ID: CPn0350

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
393181

Gene Stop:
393687

Gene Length:
507

Molecular Weight*:
19084

pI*:
10.70

Net Charge*:
13.62

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0350 is orthologously related to CT066, a hypothetical protein: residues 1-153 are 83% similar to that of CT066.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MAVEQSHIKEEIEKLIGKAIKRVCGNKENDLCRYLPGPSGGYMHHFTLKK
MKSAAPEQLLKMLKTFILESETPRTINPKPRAPRGSKKRRDFINFTKTDI
ERVLELARQVGDKDLLARFSPKKPLTSLKRELIRSIRNGIVSVELWNAYV
EAVKAVSSPNLEVTSPFV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCCGTAGAACAATCACATATAAAAGAAGAAATAGAAAAACTGATCGG
AAAAGCTATTAAAAGAGTCTGCGGAAACAAAGAAAACGATTTATGTCGCT
ATCTTCCAGGCCCTAGCGGCGGTTATATGCATCATTTCACTCTAAAAAAG
ATGAAAAGCGCTGCTCCCGAACAACTTTTAAAAATGTTAAAAACATTTAT
TTTAGAATCGGAAACCCCACGCACAATTAATCCTAAGCCTAGAGCTCCTA
GAGGCTCTAAAAAACGTCGTGACTTTATTAACTTTACTAAAACAGATATT
GAACGCGTTTTAGAACTGGCAAGACAAGTTGGAGACAAAGACCTCCTCGC
TCGCTTTAGCCCTAAAAAACCGTTAACTTCTTTAAAAAGGGAGTTAATTC
GTTCGATTCGCAACGGTATCGTGAGCGTAGAGCTATGGAATGCCTACGTC
GAAGCTGTGAAGGCTGTAAGCTCTCCCAACCTTGAAGTTACCTCTCCTTT
CGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy