Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR280 IGR278 IGR285 IGR284 IGR279 IGR283 IGR282 IGR281 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0353 CPn0350 CPn0352 CPn0354 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 ytgB_1,troB, - CPn0348 ytgB_1,troB, - CPn0348 CPn0350 CPn0352 CPn0354 adt, - CPn0351 CPn0353
* Calculated from Protein Sequence

Gene ID: CPn0349

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ytgA  troA  adhS  

Definition:
possible adhesin B precursor (possible solute binding protein)

Gene Start:
392770

Gene Stop:
391787

Gene Length:
984

Molecular Weight*:
36747

pI*:
5.70

Net Charge*:
-7.38

EC:
 

Functional Class:
cellular processes; transport related proteins  
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to binding proteins; e.g. residues 11-325 are 59% similar to CT067, a possible adhesin B precursor (possible solute binding protein); residues 17-318 are 25% similar to TP0163, an ABC transporter, periplasmic binding protein; residues 4-318 are 26% similar to (AF008220) YtgA [Bacillus subtilis]; and residues 16-318 are 21% similar to (U03756) endocarditis specific antigen [Enterococcus faecalis].
No significant similarity to M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0803
COG name: Zn-binding (lipo)protein of the ABC-type Zn transport system (surface adhesin A)
Functional Class:  P
The phylogenetic pattern of COG0803 is a-tK-QvCeBrH-----LINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 38-215 span four regions of similarity to blocks PR00690A-D (ADHESIN FAMILY SIGNATURE) with a combined E-value of 1.6e-12.
Residues 38-315 span six regions of simialrity to blocks PR0069A-E,I (ADHESIN B SIGNATURE) with a combined E-value of 4.4e-09.

ProDom Summary:  Protein Domain Search
Residues 144-318 are 29% similar to a defined domain of O34385_BACSU, defined as: PROTEIN PRECURSOR LIPOPROTEIN SIGNAL ADHESION ADHESIN MEMBRANE ZINC B TRANSPORT.

Paralogs:  Local Blast Search
CPn0541, a solute binding protein, is a possible paralog. Residues 52-215 are 22% similar to CPn0541.

Pfam Summary:  Pfam Search
Residues 15 to 319 (E-value = 1.3e-127) place CPn0349 in the SBP_bac_9 family which is described as Periplasmic solute binding protein family (PF01297)

PDB Hit:


Gene Protein Sequence:
MDAKMGYIFKVMRWIFCFVACGITFGCTNSGFQNANSRPCILSMNRMIHD
CVERVVGNRLATAVLIKGSLDPHAYEMVKGDKDKIAGSAVIFCNGLGLEH
TLSLRKHLENNPNSVKLGERLIARGAFVPLEEDGICDPHIWMDLSIWKEA
VIEITEVLIEKFPEWSAEFKANSEELVCEMSILDSWAKQCLSTIPENLRY
LVSGHNAFSYFTRRYLATPEEVASGAWRSRCISPEGLSPEAQISVRDIMA
VVDYINEHDVSVVFPEDTLNQDALKKIVSSLKKSHLVRLAQKPLYSDNVD
DNYFSTFKHNVCLITEELGGVALECQR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATGCGAAAATGGGATATATATTTAAAGTGATGCGTTGGATTTTCTG
TTTCGTGGCATGTGGTATAACTTTTGGATGTACCAATTCTGGGTTTCAGA
ATGCAAATTCACGTCCTTGTATACTATCCATGAATCGCATGATTCATGAT
TGTGTTGAAAGAGTCGTGGGGAATAGGCTTGCTACCGCTGTTTTGATCAA
AGGATCCTTAGACCCTCATGCGTATGAGATGGTTAAAGGGGATAAGGACA
AGATTGCTGGAAGTGCCGTAATTTTTTGTAACGGCCTGGGTCTTGAGCAT
ACATTAAGTTTGCGGAAGCATTTAGAAAATAATCCCAATAGTGTCAAGTT
AGGGGAGCGGTTGATAGCGCGTGGGGCCTTTGTTCCTCTAGAAGAAGACG
GTATTTGCGATCCTCATATCTGGATGGATCTTTCTATTTGGAAGGAAGCT
GTCATAGAAATTACAGAAGTTCTCATTGAAAAGTTCCCTGAATGGTCTGC
TGAATTTAAAGCAAATAGTGAGGAACTTGTTTGTGAAATGTCTATTTTAG
ATTCTTGGGCGAAACAATGCTTGAGCACAATTCCTGAAAATTTACGGTAT
CTTGTCTCAGGTCATAATGCGTTCAGTTACTTTACACGTCGCTATTTAGC
TACTCCTGAAGAAGTGGCTTCCGGAGCATGGAGGTCTCGTTGTATTTCTC
CTGAGGGTCTATCTCCAGAAGCTCAAATCAGTGTTCGTGATATTATGGCG
GTTGTAGATTATATTAATGAGCATGATGTCAGTGTGGTTTTCCCTGAGGA
TACTCTGAACCAAGATGCGTTGAAAAAAATTGTTTCTTCTCTGAAGAAAA
GTCATTTAGTTCGTCTAGCTCAAAAACCATTGTATAGTGATAATGTGGAC
GACAATTATTTTAGCACCTTTAAACATAATGTCTGCCTTATCACAGAAGA
ATTAGGAGGGGTGGCTCTTGAATGTCAAAGATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy