Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR280 IGR278 IGR279 IGR283 IGR282 IGR281 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0350 CPn0352 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0350 CPn0352 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 ytgB_1,troB, - CPn0348 ytgB_1,troB, - CPn0348 CPn0350 CPn0352 adt, - CPn0351
* Calculated from Protein Sequence

Gene ID: CPn0348

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ytgB_1  troB  

Definition:
ABC transport system component; ATP-binding protein

Gene Start:
391803

Gene Stop:
391024

Gene Length:
780

Molecular Weight*:
29046

pI*:
8.10

Net Charge*:
4.59

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to various transporter sequences; e.g. residues 1-259 are 72% similar to CT068; residues 11-241 are 47% similar to TP0164; residues 23-244 are 33% similar to CT416; residues 13-245 are 46% similar to (AF008220) putative transporter [Bacillus subtilis]; residues 10-238 are 42% similar to MNTA_SYNY3; and residues 11-238 are 42% similar to YCXD_CYAPA, a probable ABC transporter.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1121
COG name: ABC-type iron (III) transport system, ATPase component
Functional Class:  P
The phylogenetic pattern of COG1121 is a-tk-qvCeB-H-----LINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 39-50 and 142-173 represent blocks BL00211A,B (ABC transporters family proteins) with a combined E-value of 4.4e-22.

ProDom Summary:  Protein Domain Search
Residues 77-139 are 52% similar to a defined domain of Q47870_ERYRH, defined as: ATP-BINDING TRANSPORT PROTEIN IRON TRANSPORTER ABC III MEMBRANE INNER DICITRATE.
Residues 24-71 are 56% similar to a defined domain of O66871_AQUAE, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Possible paralogs include; CPn0542, CPn0191, CPn0202, CPn0723, CPn0231, CPn0280, CPn0413, CPn0683, CPn0248, CPn0201, CPn0023, CPn0096, CPn0682, and CPn0691. Residues 23-224 are 34% similar to CPn0542.

Pfam Summary:  Pfam Search
Residues 34 to 217 (E-value = 3.2e-42) place CPn0348 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
64

PDB Hit:


Gene Protein Sequence:
LNVKDETFWSVHNLCVNYEHAAVLYHISFSLGKGSLTAILGPNGAGKSTL
LKASLGLIKPSSGTVYFFNQKFKKVRQRIAYMPQRASVDWDFPMTVLDLA
LMGCYSYKGMWGRISSDDRREAFHILERVGLESVADRQIGQLSGGQQQRA
FLARALMQKADLYLMDELFSAIDMASFKTSVGVLQELRDQGKTIVVVHHD
LSHVRQLFDHVVLLNKRLICCGPTDECLNGDTIFQTYGCEIELLEQTLKL
SRGKQFGSC$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAATGTCAAAGATGAGACTTTTTGGTCTGTACACAACCTTTGTGTAAA
CTATGAGCATGCAGCCGTTCTTTATCACATATCCTTTTCCTTGGGAAAGG
GGTCATTAACTGCTATTTTAGGTCCTAATGGAGCTGGTAAAAGCACTCTC
TTAAAGGCTTCCTTAGGCCTGATCAAACCCTCTTCGGGGACTGTTTATTT
TTTTAATCAAAAATTTAAGAAGGTGCGTCAGCGCATAGCCTATATGCCTC
AGAGAGCTAGCGTGGATTGGGATTTTCCAATGACTGTCTTAGATTTAGCC
CTTATGGGGTGTTACAGCTATAAAGGAATGTGGGGGAGAATTTCTTCGGA
TGATCGAAGGGAGGCCTTTCATATTTTAGAAAGAGTTGGTTTGGAATCCG
TAGCAGATAGACAAATAGGACAGCTCTCAGGAGGACAGCAACAAAGAGCA
TTTTTAGCACGTGCTTTGATGCAAAAAGCAGATCTATATCTTATGGATGA
GTTGTTTTCAGCGATTGATATGGCTTCGTTTAAAACATCTGTAGGGGTTT
TGCAAGAGCTGCGAGATCAGGGAAAGACTATCGTCGTTGTTCATCATGAC
TTGAGTCATGTGCGTCAACTATTTGATCATGTGGTTTTATTGAATAAGCG
TTTGATTTGTTGTGGCCCTACTGATGAATGTCTGAATGGAGACACTATTT
TCCAAACGTATGGTTGTGAAATTGAACTTTTGGAACAAACCCTGAAGCTC
TCTCGAGGAAAACAATTTGGATCGTGCTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy