Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR280 IGR278 IGR279 IGR282 IGR281 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0350 CPn0340 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0350 CPn0340 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 ytgB_1,troB, - CPn0348 ytgB_1,troB, - CPn0348 CPn0350 CPn0340 adt, - CPn0351
* Calculated from Protein Sequence

Gene ID: CPn0347

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ytgC  troC  

Definition:
membrane protein with ABC transporter features

Gene Start:
391021

Gene Stop:
389675

Gene Length:
1347

Molecular Weight*:
50288

pI*:
8.60

Net Charge*:
11.08

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:
Notice hits over last 100 residues to repressor sequences.

Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to membrane proteins, ABC transporters, and iron-dependant repressor sequences; e.g. residues 1-447 are 63% similar to CT069; residues 5-312 are 28% similar to TP0165; residues 16-299 are 25% similar to TP0166; residues 6-252 are 23% similar to Y360_HAEIN; residues 6-252 are 20% similar to YFEC_YERPE; residues 29-255 are 22% similar to (X99127) membrane protein [Staphylococcus epidermidis]; and residues 335-442 are 35% similar to (X99128) putative iron dependant repressor [Staphylococcus epidermidis].

COGS Summary:  COGS Search
BeTs to 9 clades of COG1108
COG name: ABC-type Mn/Zn transport systems, ATPase component
Functional Class:  P
The phylogenetic pattern of COG1108 is a-tk-QvCeB-H-----LINx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 80-118, 246-288, and 21-67 represent blocks PF00950A-C (ABC 3 transport family) with a combined E-value of 0.00051.

ProDom Summary:  Protein Domain Search
Residues 39-249 are 27% similar to a defined domain of O35024_BACSU, defined as: PROTEIN MEMBRANE TRANSPORT TRANSMEMBRANE SYSTEM INNER ZINC MANGANESE 5'REGION ORF1.
Residues 335-442 are 35% similar to a defined domain of P72424_STAEP, defined as: REPRESSOR IRON PROTEIN TOXIN IRON-DEPENDENT DIPHTHERIA TOX REGULATORY DIPTHERIA HOMOLOG.

Paralogs:  Local Blast Search
Two probable paralogs found in C.pneumoniae: residues 5-315 are 22% similar to CPn0346, a predicted integral membrane protein; and residues 1-288 are 22% similar to CPn0543, a predicted metal transport protein.

Pfam Summary:  Pfam Search
Residues 7 to 291 (E-value = 8.2e-14) place CPn0347 in the ABC-3 family which is described as ABC 3 transport family (PF00950)
Residues 374 to 444 (E-value = 7.7e-19) place CPn0347 in the Fe_dep_repr_C family which is described as Iron dependent repressor, metal binding and dimerisation domain (PF02742)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
14  
31
transmembrane  
55  
79
transmembrane  
101  
118
transmembrane  
146  
164
transmembrane  
186  
210
transmembrane  
235  
252
transmembrane  
273  
294

PDB Hit:


Gene Protein Sequence:
MLSCVFSDTIFLSSFLAVTLICMTTALWGTILLISKQPLLSESLSHASYP
GLLVGALMAQYVFSLQASIFWIVLFGCAASVFGYGIIVFLGKVCKLHKDS
ALCFVLVVFFAIGVILASYVKESSPTLYNRINAYLYGQAATLGFLEATLA
AIVFCASLFALWWWYRQIVVTTFDKDFAVTCGLKTVLYEALSLIFISLVI
VSGVRSVGIVLISAMFVAPSLGARQLSDRLSTILILSAFFGGISGALGSY
ISVAFTCRAIIGQQAVPVTLPTGPLVVICAGLLAGLCLLFSPKSGWVIRF
VRRKHFSFSKDQEHLLKVFWHISHNRLENISVRDFVCSYKYQEYFGPKPF
PRWRVQILEWRGYVKKEQDYYRLTKKGRSEALRLVRAHRLWESYLVNSLD
FSKESVHELAEEIEHVLTEELDHTLTEILNDPCYDPHRQIIPNKKKEV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCAGTTGTGTTTTTTCTGATACGATTTTCTTATCTAGTTTTTTAGC
TGTCACTTTGATTTGTATGACCACAGCTTTGTGGGGGACAATTCTCTTGA
TTAGCAAGCAGCCTCTTTTAAGCGAAAGTTTATCTCACGCGTCGTATCCA
GGACTTCTAGTTGGAGCTTTGATGGCGCAATATGTTTTCTCATTGCAAGC
TTCTATTTTTTGGATTGTGTTGTTTGGGTGTGCTGCTTCGGTATTTGGTT
ATGGGATCATTGTTTTCTTAGGGAAAGTATGTAAATTACATAAAGACTCC
GCCCTTTGTTTTGTTCTTGTGGTATTCTTTGCTATCGGAGTGATTTTAGC
CAGTTATGTCAAGGAAAGTAGCCCTACGCTATACAATCGCATTAACGCCT
ATCTATATGGGCAAGCAGCCACTTTAGGTTTTCTTGAAGCTACGTTGGCT
GCGATCGTCTTTTGTGCTTCGTTATTTGCTTTATGGTGGTGGTATCGACA
AATTGTTGTGACTACTTTTGATAAAGATTTTGCTGTTACTTGTGGCTTAA
AGACTGTTCTTTATGAAGCACTCAGTCTAATTTTTATATCGTTGGTGATC
GTAAGTGGAGTTCGAAGCGTAGGGATTGTTTTAATTTCTGCTATGTTTGT
GGCTCCTTCTTTAGGTGCTCGTCAGCTTTCCGATCGTCTAAGTACAATTC
TTATCCTTTCTGCATTCTTTGGAGGGATTAGCGGAGCTTTAGGAAGCTAT
ATCTCTGTAGCATTCACATGTCGTGCTATTATAGGGCAACAGGCGGTGCC
TGTAACCTTGCCTACGGGACCTTTGGTTGTCATTTGTGCTGGATTATTGG
CCGGTCTATGTTTGCTTTTTTCTCCAAAATCTGGGTGGGTCATTCGTTTT
GTCCGTAGGAAGCACTTTTCGTTTTCAAAGGATCAAGAACACCTTTTAAA
GGTGTTTTGGCATATTTCTCATAATCGTTTAGAGAACATTAGTGTTCGAG
ATTTTGTCTGTAGTTATAAGTATCAGGAGTATTTTGGGCCTAAGCCTTTC
CCTAGATGGAGAGTTCAGATTTTAGAATGGCGGGGTTATGTTAAAAAAGA
ACAAGATTATTATCGACTCACAAAAAAAGGAAGAAGTGAGGCCTTAAGAT
TAGTTCGTGCTCACAGATTATGGGAATCGTATCTTGTGAATTCTTTAGAT
TTTAGCAAGGAAAGTGTTCATGAGTTGGCTGAGGAAATAGAGCATGTTCT
TACTGAAGAATTGGATCATACCTTGACAGAGATTCTCAATGATCCTTGTT
ATGATCCTCATCGACAAATTATCCCAAATAAAAAAAAGGAAGTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy