Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR280 IGR278 IGR277.1 IGR279 IGR282 IGR281 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0350 CPn0340 recF, - CPn0339 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0350 CPn0340 recF, - CPn0339 adt, - CPn0351 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 ytgB_1,troB, - CPn0348 ytgB_1,troB, - CPn0348 CPn0350 CPn0340 recF, - CPn0339 adt, - CPn0351
* Calculated from Protein Sequence

Gene ID: CPn0346

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ytgD  troD  

Definition:
membrane protein (ABC transport system component?)

Gene Start:
389675

Gene Stop:
388701

Gene Length:
975

Molecular Weight*:
35236

pI*:
9.30

Net Charge*:
6.47

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:
An integral membrane protein related to ABC transporters.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to membrane proteins and ABC sequences; e.g. residues 1-300 are 65% similar to CT070; residues 41-304 is 23% similar to TP0166; residues 45-308 are 23% similar to TP0165; residues 41-304 are 21% similar to P29K_STRPN; and residues 55-304 is 19% similar to (X99127) membrane protein [Staphylococcus epidermidis].

COGS Summary:  COGS Search
BeTs to 11 clades of COG1108
COG name: ABC-type Mn/Zn transport systems, ATPase component
Functional Class:  P
The phylogenetic pattern of COG1108 is a-tk-QvCeB-H-----LINx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 47-301 span four regions of similarity to PF00950A-C (ABC 3 transport family) with a combined E-value of 1.5e-06.

ProDom Summary:  Protein Domain Search
Residues 63-257 are 30% similar to a defined domain of O34500_BACSU, defined as: PROTEIN MEMBRANE TRANSPORT TRANSMEMBRANE SYSTEM INNER ZINC MANGANESE 5'REGION ORF1.

Paralogs:  Local Blast Search
Two possible paralogs found in C.pneumoniae: residues 34-317 are 22% similar to CPn0347, a predicted integral membrane protein; and residues 45-266 are 20% similar to CPn0543, a predicted metal transport protein.

Pfam Summary:  Pfam Search
Residues 35 to 304 (E-value = 1.4e-12) place CPn0346 in the ABC-3 family which is described as ABC 3 transport family (PF00950)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
12  
29
transmembrane  
34  
58
transmembrane  
73  
90
transmembrane  
95  
112
transmembrane  
128  
145
transmembrane  
172  
191
transmembrane  
202  
226
transmembrane  
231  
255
transmembrane  
260  
277
transmembrane  
286  
303

PDB Hit:


Gene Protein Sequence:
MALGPSPYYGVSFFQFFSVFFSRLFSGSLFTGSLYIDDIQIIVFLAISCS
GAFAGTFLVLRKMAMYANAVSHTVLFGLVCVCLFTHQLTTLSLGTLTLAA
MATAMLTGFLIYFIRNTFKVSEESSTALVFSLLFSLSLVLLVFMTKNAHI
GTELVLGNADSLTKEDIFPVTIVILANAVITIFAFRSLVCSSFDSVFASS
LGIPIRLVDYLIIFQLSACLVGAFKAVGVLMALAFLIIPSLIAKVIAKSI
RSLMAWSLVFSIGTAFLAPASSRAILSAYDLGLSTSGISVVFLTMMYIVV
KFISYFRGYFSKNFEKISEKSSQY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTTGGGACCTTCTCCTTATTATGGAGTATCTTTTTTCCAATTTTT
TTCAGTATTTTTTTCGAGACTGTTTTCTGGAAGTCTTTTCACGGGTTCTC
TCTATATTGATGATATTCAGATTATAGTATTCCTTGCTATTTCCTGTTCA
GGTGCTTTTGCAGGAACTTTTTTAGTCTTGCGAAAGATGGCTATGTATGC
GAATGCTGTCTCTCATACTGTCCTTTTTGGTTTGGTCTGTGTTTGTTTGT
TTACGCATCAACTGACGACCCTCTCTTTGGGTACCTTGACTCTTGCAGCA
ATGGCAACAGCTATGCTGACAGGGTTTCTTATTTACTTTATTCGTAATAC
TTTTAAAGTTTCAGAAGAGAGCAGCACCGCTCTAGTCTTTTCTTTATTAT
TCTCTCTGAGCCTTGTTTTGTTAGTCTTTATGACAAAGAATGCTCATATA
GGAACGGAGCTTGTGTTAGGAAACGCAGATTCTTTAACGAAAGAGGATAT
TTTCCCTGTCACTATTGTGATTTTGGCTAATGCTGTAATTACTATTTTTG
CGTTCCGTAGCTTAGTTTGTTCTTCTTTCGATTCTGTATTTGCCTCTTCT
TTAGGAATTCCTATTCGGTTGGTTGATTATTTGATTATTTTTCAACTTTC
TGCATGTCTTGTAGGAGCTTTTAAGGCTGTAGGTGTATTAATGGCACTTG
CTTTTCTGATCATTCCATCGCTTATTGCTAAGGTTATTGCAAAATCGATA
AGGAGTCTTATGGCTTGGTCGTTAGTTTTTAGTATTGGTACAGCATTTTT
AGCTCCTGCATCTTCGAGAGCAATTCTTAGTGCTTATGATTTGGGGTTAT
CGACTTCGGGAATCTCTGTAGTGTTCTTGACGATGATGTACATCGTGGTT
AAATTTATAAGCTATTTTCGAGGCTATTTTTCTAAAAATTTTGAAAAAAT
AAGTGAGAAAAGTTCTCAATATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy