Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR280 IGR278 IGR277 IGR277.1 IGR279 IGR281 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0340 recF, - CPn0339 dnaN, - CPn0338 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 CPn0340 recF, - CPn0339 dnaN, - CPn0338 ytgD,troD, - CPn0346 ytgA,troA,adhS, - CPn0349 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 ytgB_1,troB, - CPn0348 ytgB_1,troB, - CPn0348 CPn0340 recF, - CPn0339 dnaN, - CPn0338
* Calculated from Protein Sequence

Gene ID: CPn0345

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yaeM  

Definition:
conserved hypothetical protein

Gene Start:
388572

Gene Stop:
387433

Gene Length:
1140

Molecular Weight*:
42120

pI*:
5.00

Net Charge*:
-12.46

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possible YaeM-related protein.

Blast Summary:  PSI-Blast Search
CPn0345 is orthlogously related to CT071: residues 1-378 of CPn0345 are 60% similar to residues 1-378 of CT071, a predicted conserved hypothetical protein from C. trachomatis.
CPn0345 is also similar to TP0601, a predicted conserved hypothetical protein from T. pallidum.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0743
COG name: 1-deoxy-D-xylulose 5-phosphate reductoisomerase (terpenoid biosynthesis)
Functional Class:  I
The phylogenetic pattern of COG0743 is -----qvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 376 (E-value = 2.2e-253) place CPn0345 in the DXP_reductoisom family which is described as 1-deoxy-D-xylulose 5-phosphate reductoisomerase (PF02670)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
77  
148

PDB Hit:


Gene Protein Sequence:
LKHLAVLGSTGSIGRQTLEIVRRYPSEFKIISMASYGNNLRLFFQQLEEF
APLAAAVYNEEVYNEACQRFPHMQFFLGQEGLTQLCIMDTVTTVVAASSG
IEALPAILESMKKGKALALANKEILVCAGELVSKTAKENGIKVLPIDSEH
NALYQCLEGRTIEGIKKLILTASGGPLLNKSLEELSCVTKQDVLNHPIWN
MGSKVTVDSSTLVNKGLEIIEAYWLFGLENVEILAVIHPQSLIHGMVEFL
DGSVISIMNPPDMLFPIQYALTAPERFASPRDGMDFSKKQTLEFFPVDEE
RFPSIRLAQQVLEKQGSSGSFFNAANEVLVRRFLCEEISWCDILRKLTTL
MECHKVYACHSLEDILEVDGEARALAQEI$

Gene Nucleotide Sequence:  Sequence Viewer
TTGAAACATTTAGCCGTTCTTGGGTCAACAGGTAGTATTGGCCGTCAAAC
ATTAGAGATTGTGCGGCGCTATCCTTCAGAATTTAAAATTATTTCTATGG
CTTCTTATGGAAATAATCTAAGGTTATTTTTTCAGCAACTAGAGGAGTTT
GCTCCGTTAGCCGCAGCGGTCTATAACGAAGAGGTTTATAACGAGGCCTG
TCAGCGATTCCCCCATATGCAATTTTTCCTAGGCCAGGAGGGTTTAACCC
AACTTTGTATCATGGATACAGTCACTACTGTCGTTGCTGCTTCTTCAGGA
ATCGAGGCGCTACCCGCGATTCTAGAGTCGATGAAAAAAGGAAAAGCACT
AGCTTTAGCAAACAAAGAAATTTTAGTTTGTGCTGGCGAATTGGTTTCTA
AGACTGCAAAGGAAAATGGTATAAAAGTTCTTCCTATTGATAGCGAGCAT
AATGCTTTGTATCAATGTTTAGAAGGCAGGACGATTGAGGGAATCAAGAA
ACTGATTCTTACAGCTTCTGGAGGGCCTCTGCTCAACAAGTCTTTAGAAG
AGCTTTCTTGTGTAACAAAACAAGATGTTTTGAACCATCCTATATGGAAT
ATGGGTTCAAAAGTGACTGTGGACTCATCCACATTGGTCAATAAGGGACT
CGAAATTATCGAGGCGTATTGGCTGTTTGGTTTAGAAAATGTTGAAATCC
TGGCTGTAATTCATCCTCAGAGCTTAATCCATGGTATGGTAGAGTTTTTA
GATGGGAGTGTGATTTCTATCATGAATCCGCCTGATATGCTCTTCCCAAT
ACAATACGCTTTAACAGCTCCAGAGCGTTTTGCATCTCCTAGGGATGGTA
TGGATTTTTCGAAGAAACAAACTTTAGAATTTTTTCCGGTAGATGAGGAG
CGATTTCCTAGTATCCGTTTAGCACAACAGGTATTAGAGAAACAGGGGTC
TTCTGGAAGCTTTTTTAATGCAGCCAATGAAGTATTAGTGCGGAGGTTCC
TTTGCGAAGAGATTTCTTGGTGTGACATTTTACGCAAATTAACGACTCTT
ATGGAATGTCATAAGGTTTATGCCTGCCACTCTTTAGAAGATATTTTAGA
AGTAGATGGTGAGGCTAGAGCTCTTGCTCAAGAAATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy