Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR280 IGR278 IGR277 IGR277.1 IGR279 IGR276 smpB, - CPn0337 ytgB_1,troB, - CPn0348 ytgD,troD, - CPn0346 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 smpB, - CPn0337 ytgB_1,troB, - CPn0348 ytgD,troD, - CPn0346 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 smpB, - CPn0337 ytgB_1,troB, - CPn0348 ytgD,troD, - CPn0346 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338
* Calculated from Protein Sequence

Gene ID: CPn0344

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yaeL  

Definition:
metalloprotease

Gene Start:
387420

Gene Stop:
385555

Gene Length:
1866

Molecular Weight*:
69869

pI*:
8.60

Net Charge*:
6.45

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:
Possible YAEL-like protein (yaeL).

Blast Summary:  PSI-Blast Search
CPn0344 is orthologously related to CT072: residues 1-620 of CPn0344 are 59% similar to residues 1-617 of CT072, a predicted metalloprotease from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0750
COG name: Predicted membrane-associated Zn-dependent proteases 1
Functional Class:  M
The phylogenetic pattern of COG0750 is AmtK-qvCebrhUj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 615 (E-value = 3.8e-62) place CPn0344 in the Peptidase_M50 family which is described as Peptidase family M50 (PF02163)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
84
non-globular  
498  
621

PDB Hit:


Gene Protein Sequence:
MTIIYFILAALALGILVLIHELGHLVVAKAVGMAVESFSIGFGPALFKKR
IGGIEYRIGCIPFGGYVRIRGMERTKEKGEKGKIDSVYDIPQGFFSKSPW
KRILVLVAGPLANILLAVLAFSILYMNGGRSKNYSDCSKVVGWVHPVLQA
EGLLPGDEILTCNGKPYVGDKDMLTTSLLEGHLNLEIKRPGYLTVPSKEF
AIDVEFDPTKFGVPCSGASYLLYSNQVPLTKNSPMENSELRPNDRFVWMD
GTLLFSMAQISQILNESYAFVKVARNDKIFFSRQPRVLASVLHYTPYLRN
ELIDTQYEAGLKGKWSSLYTLPYVINSYGYIEGELTAIDPESPLPQPQER
LQLGDRILAIDGTPVSGSVDILRLVQNHRVSIIVQQMSPQELEEVNSRDA
DKRFIASYHSEDLLQILNHLGESHPVEVAGPYRLLDPVQPRPWIDVYSSE
SLDKQLEVAKKIKNKDKQRYYLERLDAEKQKPSLGISLKDLKVRYNPSPV
VMLSNITKESLITLKALVTGHLSPQWLSGPVGIVQVLHTGWSVGFSEVLF
WIGLISMNLAVLNLLPIPVLDGGYILLCLWEIVKRRRLNMKIVERILVPF
TFLLIIFFIFLTFQDLFRFFG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAATAATCTATTTTATTCTAGCAGCCCTAGCTTTAGGGATTTTAGT
GTTAATTCATGAACTTGGTCATCTGGTAGTAGCAAAAGCTGTAGGAATGG
CTGTAGAGAGTTTTAGCATAGGCTTTGGTCCTGCTTTATTTAAAAAGCGT
ATAGGCGGCATAGAATATCGCATTGGATGCATTCCTTTTGGAGGCTATGT
TCGTATCAGAGGTATGGAACGTACCAAAGAAAAAGGGGAGAAGGGGAAGA
TAGACTCTGTCTATGATATTCCTCAGGGATTTTTTAGTAAGTCTCCTTGG
AAACGCATTCTGGTTCTTGTTGCTGGTCCTCTTGCCAATATTTTATTAGC
TGTCTTGGCTTTCAGCATTCTTTACATGAATGGGGGAAGAAGTAAAAATT
ATAGCGACTGTTCTAAAGTGGTAGGTTGGGTCCATCCTGTTTTACAGGCA
GAAGGATTGCTCCCTGGAGACGAGATTCTTACGTGTAATGGTAAGCCTTA
TGTGGGAGATAAGGACATGCTAACAACCTCTTTATTAGAGGGGCATCTCA
ATCTAGAAATCAAACGTCCTGGCTATTTGACAGTTCCTAGCAAAGAGTTC
GCTATTGATGTTGAGTTTGATCCCACAAAATTCGGGGTTCCCTGTTCTGG
AGCGAGTTATCTTTTGTATAGCAACCAGGTGCCCCTAACGAAGAACTCTC
CTATGGAGAATTCAGAGCTACGTCCGAATGATCGTTTCGTTTGGATGGAT
GGCACACTTCTTTTCTCAATGGCTCAGATATCTCAGATACTCAATGAGTC
TTATGCTTTTGTGAAAGTAGCACGGAATGACAAAATCTTCTTTTCTCGTC
AACCTAGGGTATTGGCTTCCGTTTTACATTACACTCCCTACCTTCGTAAT
GAGCTTATAGATACGCAGTATGAGGCTGGACTTAAAGGCAAGTGGTCTTC
GTTATATACATTGCCTTATGTAATCAATAGTTATGGATACATAGAAGGTG
AACTTACTGCTATAGATCCAGAGTCTCCTTTGCCACAACCTCAAGAGAGG
CTACAGCTTGGGGATCGCATTCTAGCTATTGATGGAACTCCTGTTTCTGG
AAGTGTAGATATTTTACGTCTTGTTCAGAACCATCGGGTCTCTATTATTG
TTCAGCAGATGAGTCCGCAAGAACTTGAAGAGGTGAATTCTCGAGATGCT
GATAAGCGGTTTATCGCCTCTTATCATTCCGAAGATCTGTTACAAATTTT
GAACCATTTAGGAGAGTCTCACCCAGTAGAAGTCGCGGGTCCTTATCGTC
TTCTTGACCCTGTTCAGCCTCGTCCTTGGATTGATGTTTATTCTTCGGAG
AGTTTGGATAAACAGTTGGAAGTAGCTAAGAAGATTAAGAACAAGGATAA
ACAAAGATACTATTTGGAGCGTCTTGATGCTGAGAAGCAAAAACCATCTT
TAGGGATTTCTTTGAAAGATCTTAAGGTGAGGTATAATCCTTCACCTGTG
GTTATGTTATCAAATATTACTAAGGAAAGTTTGATCACCTTGAAAGCTTT
AGTTACTGGACATCTGAGTCCACAATGGCTTTCAGGACCTGTGGGTATTG
TGCAGGTTTTACATACAGGATGGTCGGTAGGGTTTTCTGAAGTGCTCTTT
TGGATCGGTCTAATTAGTATGAATTTGGCTGTCTTGAATTTGCTTCCTAT
TCCTGTTTTGGATGGAGGTTATATCCTTCTATGTTTGTGGGAGATAGTCA
AAAGAAGACGTTTGAATATGAAGATTGTGGAAAGGATTTTGGTTCCGTTC
ACTTTTTTATTGATCATCTTCTTTATTTTTCTAACTTTTCAGGATTTATT
TCGTTTTTTTGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy