Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR278 IGR277 IGR277.1 IGR279 IGR276 smpB, - CPn0337 ytgD,troD, - CPn0346 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 smpB, - CPn0337 ytgD,troD, - CPn0346 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 smpB, - CPn0337 ytgD,troD, - CPn0346 yaeM, - CPn0345 ytgC,troC, - CPn0347 yaeL, - CPn0344 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 folD, - CPn0335 folD, - CPn0335
* Calculated from Protein Sequence

Gene ID: CPn0340

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (a predicted OMP)

Gene Start:
384623

Gene Stop:
385598

Gene Length:
975

Molecular Weight*:
0

pI*:
10.30

Net Charge*:
20.61

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
The ORF was not recognized by the automated process due to a frameshift in the coding region. This shift was the result of a single base deletion (probably deletion of "G" at position 385028). Addition of a "G" (indicated as "g" in the nucleotide sequence) at the suspected deletion site was made to obtain the intact ORF.

Blast Summary:  PSI-Blast Search
This is a Chlamydia-specific protein with no similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0340 is orthologously related to CT073, a hypothetical protein: residues 1-323 are 66% similar to residues 1-319 of CT073.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKKFLLTILFLAVGNPLFSETSVIQTLPSGIGGLKETSKQKESVVCVHAF
LRSYTSLKPIARVLEKEHYDVFIWNYETRKFTLEKHAEHLNRLLKKIAEL
KPGVPINFVTHSIGGVIVRVALAHPDCPEEAKKEKAILMAPPNAGSTLAR
RYRCVKFVQFVFGGKLGRQLLTYCPTKMLNVGKLPSSLDVLILSGNRHSK
FLPFRLPYENDGKVCTIETKLDTPHKAYVIHTSHTYIITNRKSLYLMKEL
KEGNTTPIIEHVPEAALEQTVMEDKQKNSRLKPYPNQDIYVIHCFGSRPY
NLYGFPKKWSLNQKNEINPEKLEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAAATTTTTATTAACTATACTCTTTTTAGCTGTGGGTAATCCTTT
ATTCTCGGAAACCTCGGTAATCCAAACCCTTCCATCTGGAATTGGGGGAT
TAAAGGAAACCTCAAAACAAAAAGAATCCGTGGTCTGCGTGCATGCGTTT
TTAAGATCTTATACATCTTTAAAACCTATTGCTCGCGTTCTAGAAAAAGA
ACATTACGATGTCTTTATTTGGAATTATGAGACGCGCAAGTTTACTCTAG
AAAAGCATGCTGAACATCTCAATCGCTTGCTGAAAAAAATAGCTGAACTT
AAGCCTGGAGTCCCTATAAACTTCGTAACTCATTCTATTGGAGGAGTCAT
TGTTCGTGTAGCACTCGCTCACCCTGATTGCCCCGAAGAAGCCAAAAAAG
AAAAgGCTATTCTCATGGCTCCTCCGAACGCAGGGTCTACACTAGCTAGA
CGCTACCGCTGTGTGAAATTCGTACAGTTCGTATTTGGAGGAAAATTAGG
ACGACAGCTTCTTACCTACTGCCCCACAAAGATGTTAAATGTCGGGAAAC
TCCCTTCGTCTTTAGACGTTCTCATTCTTAGTGGGAACAGACATAGCAAA
TTCCTTCCTTTCCGCCTGCCCTATGAAAACGATGGTAAGGTATGCACTAT
AGAGACAAAGCTAGATACTCCACATAAAGCTTACGTGATCCACACGAGTC
ATACCTACATCATTACTAATCGGAAGTCGCTCTATCTTATGAAAGAGTTT
TTAAAAGAAGGAAATACAACCCCGATAATCGAGCACGTTCCCGAAGCAGC
TTTAGAACAAACTGTTATGGAAGACAAACAAAAGAACTCAAGACTTAAGC
CTTACCCTAACCAAGACATCTACGTTATACACTGCTTTGGTTCTCGTCCT
TACAACCTTTACGGATTTCCAAAAAAATGGAGCCTTAACCAAAAAAACGA
AATAAATCCTGAAAAGTTAGAAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy