Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR278 IGR277 IGR277.1 IGR279 IGR275 IGR276 ltuB, - CPn0333 smpB, - CPn0337 ytgD,troD, - CPn0346 yaeM, - CPn0345 yaeL, - CPn0344 CPn0334 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 ltuB, - CPn0333 smpB, - CPn0337 ytgD,troD, - CPn0346 yaeM, - CPn0345 yaeL, - CPn0344 CPn0334 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 Type: tandem, Name:  - 4 ltuB, - CPn0333 smpB, - CPn0337 ytgD,troD, - CPn0346 yaeM, - CPn0345 yaeL, - CPn0344 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 folD, - CPn0335 folD, - CPn0335 CPn0334
* Calculated from Protein Sequence

Gene ID: CPn0339

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
recF  

Definition:
RecF protein (ABC superfamily ATPase)

Gene Start:
383426

Gene Stop:
384501

Gene Length:
1074

Molecular Weight*:
40337

pI*:
8.40

Net Charge*:
8.24

EC:
 

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
This ORF was not recognized by the automated process due to both a frameshift and a premature termination. The frameshift was the result of a single base deletion (probably deletion of "T" at position 383897). The termination codon "TGA" at position 384159 was changed to "TGT" (encoding Cysteine) to obtain the intact RecF. The changes made were indicated as lowercase letters in the nucleotide sequence.




Blast Summary:  PSI-Blast Search
CPn0339 is similar to TP0003, a predicted RecF protein in T. pallidum: residues 10-330 are 26% similar to residues 56-376 of TP0003.

CPn0339 is orthologously related to CT074, a predicted RecF protein: residues 1-353 are 48% similar to CT074.

COGS Summary:  COGS Search
BeTs to 7 clades of COG1195
COG name: ATPases involved in DNA repair
Functional Class:  L
The phylogenetic pattern of COG1195 is -------cebrh-----li-x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MKICSLKLKNFRNHSDLEISLAPKLNYAQGKTNLLEALYVLSLGRSFRTQ
HLTDTITFGSSHFFLETQFEKDHLPQALSIYTDKQGKKICYNQLPIKTLS
QLIGKVPIVLFSSKDRLLISGAPADRRLFLNLLLSQCDNHYTLCLSYYHR
ALQQRNASLKKQANLNRGLWDEQLVKHGTYLSIQRFLCSQKLSDLSKELW
SNNLKEQLALKFKSSLIKNSDISETAVAEEFHKQLSISLPRDLECGSTSV
GPHREDFLLTMNQMPVSQFSSEGQKHSLLAILRLAECLYLKQSHHVSPLV
CLDDIHAGLDNERVGQLLDPAPTLGQTLITSTHMHGELPKTSLVLSIENA
QVSEQII$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATCTGCTCTCTGAAGCTAAAAAATTTTCGTAACCACAGTGATTT
AGAAATCTCACTGGCTCCTAAACTCAATTATGCCCAAGGAAAAACAAACC
TCCTAGAAGCGCTTTATGTTTTGTCCTTGGGAAGGTCTTTTCGCACGCAA
CATCTCACAGATACCATCACCTTCGGATCTTCCCATTTCTTCTTAGAAAC
ACAGTTTGAGAAAGACCACCTTCCCCAAGCTCTCTCCATCTATACAGACA
AGCAAGGAAAAAAAATCTGCTATAACCAACTTCCTATAAAAACCTTATCG
CAGCTGATAGGGAAAGTACCTATTGTGCTTTTCTCTTCAAAAGACCGCCT
TCTAATTTCAGGAGCTCCTGCGGATCGTCGCCTTTTCCTAAATCTGCTTT
TATCTCAATGCGATAACCACTATACCCTCTGCTTATCGTACTATCATCGC
GCTCTTCAGCAGAGAAATGCtTCTCTTAAAAAGCAAGCAAACCTCAACCG
TGGCCTCTGGGATGAACAGTTGGTCAAACACGGCACCTACCTATCCATCC
AACGGTTTCTCTGTAGTCAGAAACTTTCAGATTTATCCAAAGAACTTTGG
TCTAACAACCTAAAAGAACAATTGGCCTTAAAATTTAAAAGTTCCTTAAT
TAAAAATTCTGATATTTCTGAAACTGCTGTTGCCGAAGAATTTCATAAAC
AGCTCTCTATATCACTTCCTAGAGATCTCGAATGtGGAAGCACTTCCGTT
GGCCCTCATCGCGAAGACTTTCTACTCACTATGAACCAAATGCCTGTGTC
TCAATTCTCTAGTGAAGGGCAGAAACACAGTCTTTTGGCAATCTTAAGGC
TTGCTGAGTGCCTATATCTAAAGCAATCTCATCACGTCTCCCCTCTAGTC
TGTCTAGATGATATCCATGCTGGATTAGATAATGAACGTGTCGGTCAACT
CCTTGACCCTGCCCCAACTCTGGGTCAGACTCTGATTACTTCCACCCATA
TGCATGGGGAACTTCCAAAAACAAGCCTTGTTTTAAGTATCGAGAACGCT
CAAGTTTCTGAGCAAATTATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy