Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR278 IGR277 IGR273 IGR277.1 IGR274 IGR275 IGR276 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 yaeM, - CPn0345 CPn0331 yaeL, - CPn0344 CPn0334 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 yaeM, - CPn0345 CPn0331 yaeL, - CPn0344 CPn0334 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 Type: tandem, Name:  - 4 ltuB, - CPn0333 smpB, - CPn0337 yaeM, - CPn0345 CPn0331 yaeL, - CPn0344 CPn0332 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 folD, - CPn0335 folD, - CPn0335 CPn0334
* Calculated from Protein Sequence

Gene ID: CPn0338

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaN  

Definition:
DNA polymerase III beta chain

Gene Start:
382278

Gene Stop:
383378

Gene Length:
1101

Molecular Weight*:
40322

pI*:
4.80

Net Charge*:
-13.00

EC:
2.7.7.7  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0338 is similar to TP0002, a predicted DNA polymerase III beta. subunit in T. pallidum

CPn0338 is orthologously related to CT075, a predicted DNA Polymerase III (beta chain):
residues 1-366 is 83% similar to CPn0338.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0592
COG name: DNA polymerase III beta subunit
Functional Class:  L
The phylogenetic pattern of COG0592 is amtKyqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 119 (E-value = 1.9e-18) place CPn0338 in the DNA_pol3_beta family which is described as DNA polymerase III beta subunit, N-terminal domain (PF00712)
Residues 128 to 242 (E-value = 1.8e-25) place CPn0338 in the DNA_pol3_beta_2 family which is described as DNA polymerase III beta subunit, central domain (PF02767)
Residues 244 to 362 (E-value = 7.6e-10) place CPn0338 in the DNA_pol3_beta_3 family which is described as DNA polymerase III beta subunit, C-terminal domain (PF02768)

PDB Hit:


Gene Protein Sequence:
MKFVVSRNELGNLIKKIQSVVPQNTPIPVLTHVLIETYNDELVFTATDLT
VSTRCVTKAKVYEKGAISIPSKRFFQLVKELTEANLEISSSAGEMAQITS
GSSCFRLLSMEKEDFPMLPDIQNALRFSLPAEQLKTMLQRTSFAVSREES
RYVLTGVLLAIANGVATIVGTDGKRLAKIDAEVTLDKSFSGEYIIPIKAV
EEIIKMCSDEGEAAIFLDQDKIAVECDNTLLITKLLSGEFPDFSPVISTE
SNVKLDLHREELITLLKQVALFTNESSHSVKFSFLPGELTLTANCTKVGE
GKVSMAVNYSGELLEIAFNPFFFLDILKHSKDELVSLGISDSYNPGIITD
SASGLFVIMPMRLHDD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTCGTTGTATCCCGAAATGAGCTAGGAAACCTTATCAAAAAAAT
TCAAAGTGTCGTCCCTCAAAACACACCTATTCCAGTACTCACCCATGTTT
TGATTGAAACTTATAATGATGAATTAGTTTTCACTGCTACGGATCTGACA
GTGAGCACACGTTGCGTCACCAAAGCTAAAGTCTATGAGAAAGGCGCTAT
TTCCATTCCCTCCAAGAGATTTTTTCAATTAGTAAAAGAATTAACAGAGG
CAAATTTAGAAATTTCCTCTTCAGCAGGGGAAATGGCACAAATCACCTCG
GGATCTTCATGCTTTCGCCTACTCAGCATGGAAAAAGAAGACTTCCCCAT
GCTCCCTGATATACAAAATGCTTTGCGTTTTTCCTTGCCTGCAGAGCAGC
TAAAAACCATGCTACAGAGAACTTCATTCGCTGTATCTAGAGAAGAAAGC
CGCTATGTTCTTACTGGAGTCCTGCTTGCTATCGCCAATGGCGTGGCTAC
CATCGTAGGGACTGACGGAAAGCGTTTAGCAAAAATAGATGCTGAAGTTA
CTTTAGATAAAAGTTTTTCTGGGGAATATATTATTCCTATCAAAGCAGTA
GAAGAAATTATAAAGATGTGCTCCGATGAAGGTGAAGCTGCGATCTTCTT
GGATCAAGATAAGATTGCGGTTGAATGTGACAATACTCTCCTGATCACAA
AACTTCTTTCTGGAGAATTTCCAGATTTCTCCCCCGTCATATCTACAGAA
AGCAACGTAAAACTCGATCTGCATCGCGAAGAACTAATTACTCTGCTCAA
ACAAGTGGCTTTATTTACAAATGAGTCCTCTCACTCCGTGAAGTTTTCTT
TCTTACCCGGAGAGCTCACTCTAACAGCCAACTGTACTAAGGTGGGTGAA
GGAAAGGTAAGCATGGCTGTAAATTATTCTGGCGAACTCCTAGAAATTGC
CTTTAATCCCTTTTTCTTTTTAGATATCCTGAAGCATAGTAAGGATGAAT
TAGTCAGCTTAGGGATCTCGGATTCCTATAATCCTGGAATCATTACCGAT
TCTGCCTCAGGATTATTTGTCATCATGCCTATGAGGCTACATGATGATTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy