Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR277 IGR273 IGR277.1 IGR274 IGR275 IGR276 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0331 yaeL, - CPn0344 CPn0334 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0331 yaeL, - CPn0344 CPn0334 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 Type: tandem, Name:  - 4 ltuB, - CPn0333 smpB, - CPn0337 CPn0331 yaeL, - CPn0344 CPn0332 yojL, - CPn0336 CPn0340 recF, - CPn0339 dnaN, - CPn0338 folD, - CPn0335 folD, - CPn0335 CPn0334
* Calculated from Protein Sequence

Gene ID: CPn0337

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
smpB  

Definition:
small protein B (SMPB)

Gene Start:
382027

Gene Stop:
381572

Gene Length:
456

Molecular Weight*:
17433

pI*:
11.00

Net Charge*:
17.10

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0337 is orthologously related to CT076: residues 1-150 of CPn0337 are 75% similar to residues 1-150 of CT076, a predicted small protein B (SmpB) from C. trachomatis.
CPn0337 is also similar to TP0184, UU058, MG059, all predicted small protein B.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0691
COG name: tmRNA-binding protein SmpB
Functional Class:  O
The phylogenetic pattern of COG0691 is -----qvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 71 (E-value = 1.7e-26) place CPn0337 in the SmpB family which is described as SmpB protein (PF01668)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
124  
151

PDB Hit:


Gene Protein Sequence:
MAQKEIVSNRKALRNYEVIETLEAGIVLTGTEIKSLRDHGGNLGDAYVIV
SKGEGWLLNASIAPYRFGNIYNHEERRKRKLLLHRYELRKLEGKIAQKGM
TLIPLGMFLSRGYVKVRLGCCRGKKAYDKRRTIIEREKEREVAAAMKRRH
H$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACAAAAAGAAATTGTTTCTAATCGCAAGGCTCTGCGTAACTATGA
AGTTATAGAGACTTTAGAAGCAGGCATCGTTTTGACTGGGACTGAGATTA
AGTCGTTGCGCGATCATGGGGGAAACCTCGGTGATGCTTATGTCATTGTT
TCTAAAGGTGAGGGGTGGTTATTAAACGCGAGTATTGCTCCCTATCGGTT
TGGAAATATCTATAACCATGAGGAGCGTCGTAAACGTAAACTCCTTCTTC
ATAGATATGAACTTCGTAAGTTAGAGGGTAAGATTGCTCAAAAGGGCATG
ACTTTGATTCCTCTGGGAATGTTTCTGAGTCGCGGCTATGTTAAGGTACG
TTTGGGTTGTTGTCGTGGGAAAAAAGCTTATGATAAGCGTCGTACGATCA
TAGAAAGAGAAAAGGAACGTGAAGTTGCCGCTGCTATGAAGAGGCGCCAT
CATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy