Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR272 IGR277 IGR271 IGR273 IGR277.1 IGR274 IGR275 IGR276 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 yaeL, - CPn0344 CPn0334 yojL, - CPn0336 CPn0340 CPn0329 recF, - CPn0339 dnaN, - CPn0338 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 yaeL, - CPn0344 CPn0334 yojL, - CPn0336 CPn0340 CPn0329 recF, - CPn0339 dnaN, - CPn0338 Type: tandem, Name:  - 4 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 yaeL, - CPn0344 CPn0332 yojL, - CPn0336 CPn0340 CPn0329 recF, - CPn0339 dnaN, - CPn0338 folD, - CPn0335 folD, - CPn0335 CPn0334
* Calculated from Protein Sequence

Gene ID: CPn0336

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yojL  

Definition:
conserved hypothetical protein (inner membrane lipoprotein)

Gene Start:
380650

Gene Stop:
381594

Gene Length:
945

Molecular Weight*:
35343

pI*:
6.20

Net Charge*:
-5.58

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
YojL family protein (yojL).

Blast Summary:  PSI-Blast Search
CPn0336 is orthologously related to CT077: residues 7-310 of CPn0336 are 52% similar to residues 8-312 of CT077, a predicted conserved hypothetical protein (inner membrane lipoprotein) from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1477
COG name: Membrane-associated lipoprotein ApbE involved in thiamine biosynthesis
Functional Class:  H
The phylogenetic pattern of COG1477 is -----qv-e--h-----lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 313 (E-value = 4.1e-160) place CPn0336 in the ApbE family which is described as ApbE family (PF02424)

PDB Hit:


Gene Protein Sequence:
MAMLPKFFLVLLCLGLCSCSQKTTTIEGEQMTIFYRIVLGTSLSAKEKAS
LSQQIDRCFHKIDSIYNNWNPYSELSIINRAPADVPITLSVELSEFLDQV
DTLYKLSEGRFDPTVGPLKTLWLLHLKSQTLPPKDVWEQHYKDMGWQHLE
FQSNTKTLIKKNPHVQIDLCGVVKGYAVDCLNEICNTFCPNNYVEWGGEI
KTSGHHPSGRPWRIFSEAAGTILDIDDMAIATSGNHIQKWCVEGKIYTHI
LDTRTGKPLELSSYPIQSVSVVHPSCAYADAIATVLMTFDSKIEAKQWAE
EHHILTYINDGASS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGATGTTACCAAAATTTTTCTTAGTTCTTTTATGTCTTGGACTCTG
TTCATGCTCTCAAAAAACGACAACAATCGAAGGAGAGCAGATGACAATCT
TCTATCGCATTGTTCTGGGAACCTCTTTATCCGCAAAAGAAAAAGCATCT
TTATCCCAACAAATTGATAGATGCTTTCATAAGATCGACTCGATTTATAA
CAACTGGAATCCCTATTCTGAACTCTCGATAATCAACCGAGCTCCAGCAG
ATGTCCCCATAACTTTATCTGTAGAACTTTCCGAGTTTCTAGATCAGGTA
GATACACTTTACAAACTTTCAGAAGGACGTTTTGACCCTACTGTAGGACC
TTTAAAAACCCTATGGCTTCTACATCTCAAAAGTCAAACCCTCCCCCCTA
AAGACGTTTGGGAACAACATTATAAAGACATGGGCTGGCAACACTTGGAG
TTTCAGTCAAACACAAAAACTCTAATCAAAAAGAATCCTCATGTTCAAAT
CGACCTCTGTGGTGTTGTCAAAGGTTATGCCGTAGATTGTCTAAATGAAA
TTTGCAATACCTTTTGTCCGAACAACTATGTAGAGTGGGGAGGAGAGATC
AAAACGTCAGGGCATCATCCCTCGGGAAGACCTTGGCGTATTTTTTCTGA
AGCAGCAGGTACGATCTTAGATATCGATGATATGGCAATTGCAACAAGTG
GAAATCATATTCAAAAATGGTGTGTTGAAGGAAAAATTTACACCCATATT
CTTGATACTCGTACAGGGAAACCCCTAGAGCTAAGCTCCTATCCTATCCA
AAGTGTTTCAGTAGTCCATCCGAGCTGCGCATACGCCGACGCTATTGCCA
CAGTCCTCATGACTTTTGATTCTAAAATAGAAGCAAAACAGTGGGCTGAA
GAACACCATATCCTAACCTATATCAATGATGGCGCCTCTTCATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy