Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR272 IGR277 IGR271 IGR273 IGR277.1 IGR274 IGR275 IGR276 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0334 yojL, - CPn0336 CPn0340 CPn0329 recF, - CPn0339 dnaN, - CPn0338 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0334 yojL, - CPn0336 CPn0340 CPn0329 recF, - CPn0339 dnaN, - CPn0338 Type: tandem, Name:  - 4 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0332 yojL, - CPn0336 CPn0340 CPn0329 recF, - CPn0339 dnaN, - CPn0338 folD, - CPn0335 folD, - CPn0335 CPn0334
* Calculated from Protein Sequence

Gene ID: CPn0335

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
folD  

Definition:
methylenetetrahydrofolate dehydrogenase

Gene Start:
379817

Gene Stop:
380677

Gene Length:
861

Molecular Weight*:
30618

pI*:
7.50

Net Charge*:
1.73

EC:
1.5.1.15  

Functional Class:
biosynthesis of cofactors, prosthetic groups and carriers; folate  

Pathway: pathway table
One carbon pool by folate

Comment:
This protein, a homodimer in B.subtilis, appears to be necessary for
purine, thymidylate, histidine, pantothenate, methionine and formyl-Met-tRNA synthesis.

Blast Summary:  PSI-Blast Search
CPn0335 is orthologously related to CT078, a predicted methylenetetrahydrofolate dehydrogenase:
residues 1-282 are 67% similar to CT078. It is also similar to TP0732,
MG013 and UU337, all predicted folD proteins.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0190
COG name: 5,10-methylene-tetrahydrofolate dehydrogenase
Functional Class:  H
The phylogenetic pattern of COG0190 is ----Yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 114 (E-value = 3.2e-63) place CPn0335 in the THF_DHG_CYH family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain (PF00763)
Residues 116 to 286 (E-value = 1.5e-106) place CPn0335 in the THF_DHG_CYH_C family which is described as Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain (PF02882)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
203  
221

PDB Hit:


Gene Protein Sequence:
MLLRGIPAAEKILQRLKEEISQSPTSPGLAVVLIGNDPASEVYVGMKVKK
ATEIGIISKAHKLPSDSTLSSVLKLIERLNQDPSIHGILVQLPLPKHLDS
EVILQAISPDKDVDGLHPVNMGKLLLGNFDGLLPCTPAGIIELLNYYEIP
LRGRHAAIVGRSNIVGKPLAALMMQKHPQTNCTVTVLHSQSENLPEILKT
ADIIIAALGAPLFIKETMVAPHAVIVDVGTTRVPADNAKGYTLLGDVDFN
NVVTKCAAITPVPGGVGPMTVAMLMSNTWRCYQNFS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTACTGAGAGGGATTCCTGCAGCTGAAAAAATCCTTCAGAGACTCAA
AGAGGAAATCTCACAAAGTCCTACCTCTCCGGGGCTTGCTGTGGTCCTGA
TTGGCAATGACCCCGCATCTGAGGTGTACGTTGGCATGAAAGTCAAAAAA
GCTACAGAAATCGGAATTATCTCCAAAGCGCACAAGTTACCCTCTGACTC
TACCCTCTCCTCAGTCCTTAAGCTCATAGAACGATTGAATCAAGATCCTA
GCATCCACGGCATCCTCGTGCAACTTCCCTTGCCCAAACACTTGGACAGC
GAAGTGATTCTCCAAGCGATCTCCCCAGACAAAGATGTGGACGGGCTTCA
CCCTGTGAACATGGGAAAGTTGCTCCTTGGAAATTTTGATGGACTTCTAC
CCTGCACTCCTGCAGGAATTATTGAACTCCTGAACTATTATGAAATTCCT
CTTCGAGGCCGCCATGCCGCTATTGTAGGGAGAAGCAACATCGTGGGGAA
ACCCTTAGCGGCCCTCATGATGCAAAAGCATCCTCAAACTAACTGTACAG
TCACAGTTCTTCATAGCCAGTCGGAAAACCTCCCAGAAATCTTAAAGACA
GCTGATATCATTATTGCTGCTCTAGGAGCACCGCTTTTTATAAAGGAAAC
TATGGTAGCCCCACATGCTGTGATCGTAGATGTAGGAACAACAAGAGTCC
CTGCAGACAATGCGAAAGGCTATACTCTTCTTGGGGATGTAGATTTTAAT
AACGTTGTGACAAAATGCGCAGCAATCACTCCAGTTCCTGGAGGCGTTGG
TCCCATGACTGTCGCTATGCTCATGAGCAATACATGGCGATGTTACCAAA
ATTTTTCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy