Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR272 IGR277 IGR271 IGR270 IGR273 IGR277.1 IGR274 IGR275 IGR276 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0334 yojL, - CPn0336 CPn0329 recF, - CPn0339 dnaN, - CPn0338 CPn0328 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0334 yojL, - CPn0336 CPn0329 recF, - CPn0339 dnaN, - CPn0338 CPn0328 Type: tandem, Name:  - 4 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0332 yojL, - CPn0336 recF, - CPn0339 dnaN, - CPn0338 CPn0328 folD, - CPn0335 folD, - CPn0335 CPn0334 CPn0329
* Calculated from Protein Sequence

Gene ID: CPn0334

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
379311

Gene Stop:
379826

Gene Length:
516

Molecular Weight*:
19243

pI*:
8.90

Net Charge*:
8.99

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0334 is related to CT079, a hypothetical protein: residues 15-150 are 26% similar to CT079.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
15  
39
transmembrane  
60  
81
transmembrane  
97  
117
transmembrane  
139  
159

PDB Hit:


Gene Protein Sequence:
MSVHITPRKCFILCILSMFTLPTLFPKAHLILFSPYIVLCFYCFSKDKGL
VLALGCGVLSDLALGSRGVFLLLYPLTALITHKAHLIFSKESKAALVIVN
MIFYGVFLLLTIPMCALFGHEVRWSIDVLMIPLKCSFLDNLIFTSVIYIL
PCAINSGIHKMISFFRRLVCY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTGTCCACATAACACCGCGCAAATGCTTTATTTTGTGTATTTTATC
CATGTTCACCCTTCCAACGCTCTTCCCTAAAGCACATCTGATCCTTTTTT
CCCCTTATATTGTTCTTTGTTTCTATTGTTTCTCAAAAGATAAGGGACTG
GTACTCGCTCTAGGCTGTGGTGTCTTAAGTGATCTTGCCTTAGGAAGCCG
CGGTGTATTTCTACTGCTCTACCCTCTAACTGCTCTGATCACCCATAAGG
CACACCTCATTTTTTCAAAAGAGAGCAAAGCCGCCTTGGTCATTGTGAAT
ATGATTTTCTATGGAGTCTTTTTACTCCTAACCATTCCTATGTGCGCCTT
GTTCGGACATGAAGTCCGTTGGTCAATAGATGTGCTAATGATACCTCTAA
AATGTTCTTTCTTAGATAATCTCATCTTCACTTCTGTAATCTATATACTT
CCTTGCGCAATAAACTCAGGAATCCATAAAATGATATCTTTTTTTAGGAG
ATTGGTATGTTACTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy