Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR272 IGR277 IGR271 IGR270 IGR273 IGR274 IGR275 IGR276 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0334 yojL, - CPn0336 CPn0329 recF, - CPn0339 dnaN, - CPn0338 CPn0328 CPn0332 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0334 yojL, - CPn0336 CPn0329 recF, - CPn0339 dnaN, - CPn0338 CPn0328 Type: tandem, Name:  - 4 ltuB, - CPn0333 smpB, - CPn0337 CPn0330 CPn0331 CPn0332 yojL, - CPn0336 CPn0329 recF, - CPn0339 dnaN, - CPn0338 CPn0328 folD, - CPn0335 folD, - CPn0335 CPn0334
* Calculated from Protein Sequence

Gene ID: CPn0333

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ltuB  

Definition:
late transcription unit B

Gene Start:
379090

Gene Stop:
378797

Gene Length:
294

Molecular Weight*:
11494

pI*:
11.00

Net Charge*:
14.47

EC:
 

Functional Class:

Pathway: pathway table

Primary Evidence:
Fahr,M.J., Douglas,A.L., Xia,W. and Hatch,T.P. 1995. Characterization of late gene promoters of Chlamydia-trachomatis. J. of Bacteriology 177(15): 4252-4260.


Comment:


Blast Summary:  PSI-Blast Search
CPn0333 is orthologously related to CT080, a predicted LtuB protein. Residues 6-97 are 40% similar to CT080.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
97

PDB Hit:


Gene Protein Sequence:
MGKPKKSRTDRALAQEIQKKSTEVLKKPARIKAKNRRKFLIAKEQKTLKH
RAQEYDQLVRSLLDSQKKDTDKVLIFNYENGFVFTDKDHFSKYSIRL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGAAGCCTAAGAAGAGCAGAACGGATAGGGCTTTGGCTCAGGAGAT
TCAAAAGAAATCAACGGAAGTGTTGAAGAAGCCTGCGCGGATAAAAGCTA
AAAATCGTCGTAAATTTCTTATTGCTAAGGAACAGAAAACTCTTAAACAC
CGTGCTCAAGAATACGATCAGTTAGTTCGCTCTCTCTTAGATTCTCAGAA
GAAGGACACCGATAAAGTTTTGATTTTCAATTATGAGAATGGGTTTGTTT
TTACTGACAAGGACCATTTTAGTAAGTACTCTATCCGTCTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy